KEGG   Paenalcaligenes hominis: PAEH1_08525Help
Entry
PAEH1_08525       CDS       T04704                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
phn  Paenalcaligenes hominis
Pathway
phn00071  Fatty acid degradation
phn00072  Synthesis and degradation of ketone bodies
phn00280  Valine, leucine and isoleucine degradation
phn00310  Lysine degradation
phn00362  Benzoate degradation
phn00380  Tryptophan metabolism
phn00620  Pyruvate metabolism
phn00630  Glyoxylate and dicarboxylate metabolism
phn00640  Propanoate metabolism
phn00650  Butanoate metabolism
phn00900  Terpenoid backbone biosynthesis
phn01100  Metabolic pathways
phn01110  Biosynthesis of secondary metabolites
phn01120  Microbial metabolism in diverse environments
phn01130  Biosynthesis of antibiotics
phn01200  Carbon metabolism
phn01212  Fatty acid metabolism
phn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:phn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAEH1_08525
   00630 Glyoxylate and dicarboxylate metabolism
    PAEH1_08525
   00640 Propanoate metabolism
    PAEH1_08525
   00650 Butanoate metabolism
    PAEH1_08525
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PAEH1_08525
   00072 Synthesis and degradation of ketone bodies
    PAEH1_08525
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAEH1_08525
   00310 Lysine degradation
    PAEH1_08525
   00380 Tryptophan metabolism
    PAEH1_08525
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PAEH1_08525
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PAEH1_08525
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAEH1_08525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phn04147]
    PAEH1_08525
Enzymes [BR:phn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PAEH1_08525
Exosome [BR:phn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAEH1_08525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AQS51597
UniProt: A0A1U9K0N9
Position
complement(1706548..1707729)
Genome map
AA seq 393 aa AA seqDB search
MSDPVVILSAVRTPMGAMTGSLSGLAAHELGAVAIKAALERAAVSPELVDEVLMGNVLQA
GQGQAPARQAAIGAGLPANAPCTTVHKVCGSGLKAAMLAHDMLKAGSAQIVVAGGQESMS
NAPYLLLKGRQGYRYGHSTVYDHMALDGLEDAYQGTAMGVLAESCAEKYAFTREEQDAFA
LESLRRAREATEKGHFKAEIAPVTISGRKGDTVVDTDEAPTRAMPEKIPSLRPAFKKDGT
ITAANASSISDGAAALVITLQSVADANQLKPIAKIVGHTQFAHEPEWFTTAPVGAMQTLL
DKLGWTVDDVDLFEINEAFAVVTMAAMKELNIPHDKVNIYGGATALGHPIGASGARLVAT
LINALQQTGGKRGIASLCIGGGEAVALAVELVD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatcctgttgtcattctgtctgctgtccgtaccccgatgggtgcaatgaccggc
agtctctccggtctcgcggctcacgagttaggtgctgttgccatcaaggcggcattagag
cgtgcggccgttagccccgagctggttgacgaggtgttaatgggtaacgtgcttcaagcc
ggccaaggtcaagcccctgctcgccaagccgccattggggcgggtttgcccgccaatgcc
ccatgtactaccgtacataaagtgtgtggttcgggcctaaaagcagctatgcttgctcac
gacatgcttaaagctggcagtgctcaaatcgtagtagcgggcggccaagaaagcatgagt
aacgccccttatttgttgctaaaagggcgtcaaggctatcgctacggtcactccaccgtg
tatgaccatatggcattagacggtctcgaagacgcataccaaggcacggcaatgggtgtg
ttagcggaaagctgtgctgaaaaatatgcttttacgcgcgaagaacaagacgcatttgcc
ttggaatctttacgacgcgcccgcgaagccacagaaaaagggcatttcaaagcagaaatt
gcaccggtgacgatcagcggccgtaaaggcgataccgtggtggacacagacgaagccccc
acacgcgcgatgcccgaaaaaatcccaagcttgcgccccgcttttaagaaagacggcaca
attactgcggccaacgcgtcctcgatttcagatggtgcggcggctttggtcatcacctta
caatctgtggccgatgccaaccaactcaagccgatcgctaagatcgtgggacacacgcaa
tttgcacacgagccagagtggttcaccaccgctcctgtcggcgccatgcaaacgctctta
gacaaactcggctggacagtagacgacgtggatctatttgaaattaacgaagcctttgcc
gtggtcaccatggccgccatgaaagagctcaatatccctcacgataaagtcaacatttac
ggcggagccaccgcgttgggccaccccattggggcctcaggggcgcgtttggtggcaaca
cttatcaacgcactgcaacaaaccggcggcaagcgtggcatagcttcgctatgtattggt
ggcggcgaagccgtcgctttagccgtagaactcgtcgactaa

DBGET integrated database retrieval system