KEGG   Paenalcaligenes hominis: PAEH1_09960Help
Entry
PAEH1_09960       CDS       T04704                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
phn  Paenalcaligenes hominis
Pathway
phn00130  Ubiquinone and other terpenoid-quinone biosynthesis
phn00627  Aminobenzoate degradation
phn01100  Metabolic pathways
phn01110  Biosynthesis of secondary metabolites
phn01120  Microbial metabolism in diverse environments
phn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:phn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    PAEH1_09960
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PAEH1_09960
Enzymes [BR:phn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     PAEH1_09960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein GATase_4
Motif
Other DBs
NCBI-ProteinID: AQS51799
UniProt: A0A1U9K1H6
Position
2010547..2011119
Genome map
AA seq 190 aa AA seqDB search
MPNPKKRIVVAITGATGALYAIRTLHKLKQLPDVETHVIVSPSGLLNLQHELSLQRADLL
ELVDVMHNFKDIGATVASGSFKTDGMIIVPCSMRTLAAVAHGLADNLITRAADVVLKERR
RLVMVVRETPFNLAHLRNMTAVTEMGAVVFPPLPAFYFQPQTITELVDHSVVRMLEHLDL
ELDGPAWAGL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatccaaaaaaacggattgtggtggcaataacgggcgctacaggcgccctttat
gccattcggacgctgcacaagctaaagcaattgcccgatgtagaaacgcatgtgattgtt
tcgccatcaggtttgcttaacttgcagcacgagctaagcctccaacgtgctgatttgctc
gagttggtcgatgtcatgcataactttaaagacattggcgctactgtcgccagtggcagt
tttaaaacggatggcatgatcatcgtaccgtgctcgatgcgtaccttggccgccgtcgcg
catggcttagccgacaatctcattacccgtgcggccgatgtggtgctcaaagagcgtcga
cgtcttgtcatggtggtgcgcgaaactccatttaacttggcccacttacgcaatatgacg
gcagtaacagaaatgggagccgtcgtgtttcccccattgcctgctttttattttcagccc
cagactattaccgagctcgttgatcacagtgtcgtgcgcatgctagaacatcttgatcta
gagctagacggaccggcgtgggcaggcttataa

DBGET integrated database retrieval system