KEGG   Paenalcaligenes hominis: PAEH1_12555Help
Entry
PAEH1_12555       CDS       T04704                                 

Definition
(GenBank) histidine ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
phn  Paenalcaligenes hominis
Pathway
phn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:phn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAEH1_12555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:phn02000]
    PAEH1_12555
Transporters [BR:phn02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    PAEH1_12555
   Histidine transporter
    PAEH1_12555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AQS52154
UniProt: A0A1U9K2F9
Position
complement(2539345..2540034)
Genome map
AA seq 229 aa AA seqDB search
MSLMGYGPQLLAGTWETIKLAILSLIVAVLLGLIAASAKLSKNRGARFVAALYTTLIRGI
PDLVLLLLIFFSMQLYLNTLTDALHLPYIDIEPFSAGVLTLGFIYGAYFTETFRGAFMAI
PAGQAEAAVAYGFSRWQVFSRIQFPQMMRHAIPGLGNNWQVLLKATALVSLIGLNDLVKV
AQNAGNVTFKVFLFISVTGLIYLALTTVSNAVLYLLEKRYSVGVKRAEL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaatgggttacggcccgcaattactagcgggcacttgggaaaccattaaatta
gccattctgtccttgatcgtggcagttttacttgggctaattgcagccagcgcgaaactc
tcaaaaaatcgaggcgcgcggtttgtggctgcactttacaccacacttatacgcggcatt
cccgatttagtgctgttgctgcttatcttctttagcatgcagctttatctcaatacattg
accgatgcgctgcacttaccctatatcgatattgagcctttttctgcaggtgtgttgacc
ctaggctttatttatggtgcctattttacggaaacctttagaggtgcgtttatggctatt
cccgcaggccaagccgaagccgccgtggcttatgggttttcgcgttggcaggtctttagc
cgtattcagtttcctcaaatgatgcgtcatgcaattcctggtttgggcaataactggcaa
gttttactcaaggccacggcgttggtgtcattaattggtcttaacgacctcgtcaaagtc
gcgcaaaatgcaggcaatgtgacctttaaagtcttcctcttcattagtgtgaccggcctg
atttatctggctttaaccacggtatccaatgctgtcctgtacctattggaaaaacgttat
tctgtgggcgtaaaacgagctgagctatga

DBGET integrated database retrieval system