KEGG   Pyrococcus horikoshii: PH0240Help
Entry
PH0240            CDS       T00014                                 

Gene name
PH0240
Definition
(GenBank) 449aa long hypothetical amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00230  Purine metabolism
pho00250  Alanine, aspartate and glutamate metabolism
pho01100  Metabolic pathways
pho01110  Biosynthesis of secondary metabolites
pho01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PH0240 (PH0240)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PH0240 (PH0240)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pho01002]
    PH0240 (PH0240)
Enzymes [BR:pho01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     PH0240 (PH0240)
Peptidases [BR:pho01002]
 Cysteine Peptidases
  Family C44
   PH0240 (PH0240)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_7 GATase_6 Pribosyltran GATase_4 PRTase_2
Motif
Other DBs
NCBI-ProteinID: BAA29312
UniProt: O57979
Position
212958..214307
Genome map
AA seq 449 aa AA seqDB search
MRGEIMKEKCGIFGAYSQDATKKTYYGLMALQHRGQEGAGISVWDGDIRTVKGHGLVSEV
FKGGSIRRLNGNPVIGHVRYSTSGSLSEVQPLEVECCGYKVSIAHNGTLTNFLPLRRFYE
SRGFKFRSSIDTEVIAVSFLNHYSELKDEFEAMSRVFEEVKGAYSVLMLFNGKLIAVRDP
VGFRPLSFGAGDGYYFSSEDSALRMFCTNIRDVSPGEVIVVKDGEAESKIVGRSEHAYCV
FEYIYFARPDSIINGISVYWARYRMGVELARESPAEGDVVIAVPDSGRTAALGFAHESGI
PYMEGLIKNRYIGRTFIMPSGREIKVRLKLSPVKEVIKGRRIVLVDDSIVRGTTMKNIVK
MLRDAGAREVHVRIASPPIRYPCYMGIDIPTRHELIAAWKSIEEIKKEIGADSLAYLSVE
GLKRAIGTDKLCMACLTGNYPEWAFDFKV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtgaaatcatgaaagagaagtgtgggatctttggggcttattcccaggatgca
actaaaaagacttattatggcctaatggccctccaacacagggggcaagaaggggctgga
attagtgtctgggatggggatataagaacggttaaaggtcatgggcttgtttccgaagtc
tttaaggggggcagtattcggaggttaaatggtaatcccgtgatagggcacgttaggtac
tcaacatcgggttccctttcagaagtccaaccgctggaggttgaatgttgtgggtataag
gtatctatagctcataacggcacgcttacaaattttcttcccctaaggaggttttatgaa
agtagaggatttaaatttcgctcttccatcgatacggaagttatagcggtctctttttta
aatcattactctgagctgaaggatgaatttgaagccatgagtagagtttttgaagaagtt
aaaggggcttattcagttttaatgttgttcaatggaaagcttatagccgttagggatcct
gtgggttttaggcctctgagttttggagctggggatggatattacttctcttccgaggat
tctgctctcaggatgttctgtactaacataagggatgtatctcccggtgaggttattgta
gttaaggatggggaagcagagagtaagatagttggaagatccgagcatgcatattgcgtc
ttcgagtatatatactttgcaagacctgatagcattataaacggaataagcgtttactgg
gctcgctatagaatgggagttgaattggctagggaaagtccagctgagggagatgtggta
atagctgttcccgattcagggagaactgcagctttgggttttgctcacgagagtgggatc
ccctacatggaggggcttataaagaatcgctatatcgggagaaccttcataatgccaagt
gggcgagaaatcaaggttaggttaaagctctccccagttaaagaagtcattaagggaagg
aggatagttcttgttgatgattcaatagtaaggggaacaacgatgaagaacattgtgaag
atgcttagagatgcgggggctagggaagtgcacgtgagaatagcatctcccccgataagg
tatccatgctatatggggatagacattccgacaagacatgagcttatagcagcttggaag
agtattgaggagataaagaaagagattggagctgattctctagcctacctaagtgtagag
gggcttaagagggctatagggactgataagctttgcatggcatgtttaactggaaactat
ccagagtgggcttttgactttaaggtttag

DBGET integrated database retrieval system