KEGG   Pyrococcus horikoshii: PH0413
Entry
PH0413            CDS       T00014                                 
Symbol
PH0413
Name
(GenBank) 356aa long hypothetical glucose-1-phosphate thymidylyltransferase
  KO
K00973  glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00521  Streptomycin biosynthesis
pho00523  Polyketide sugar unit biosynthesis
pho00525  Acarbose and validamycin biosynthesis
pho01100  Metabolic pathways
pho01110  Biosynthesis of secondary metabolites
pho01250  Biosynthesis of nucleotide sugars
Module
pho_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PH0413 (PH0413)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PH0413 (PH0413)
   00525 Acarbose and validamycin biosynthesis
    PH0413 (PH0413)
Enzymes [BR:pho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.24  glucose-1-phosphate thymidylyltransferase
     PH0413 (PH0413)
SSDB
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Fucokinase
Other DBs
NCBI-ProteinID: BAA29499
UniProt: O58150
Position
376565..377635
AA seq 356 aa
MVDTMKALILSGGYGTRLRPLTYSQQKQLIPVANKPVLFYAIEDVIEAGIHEIGIVVGPN
ADLVKKTVMSVDWDANIEFIYQGEPKGLAHAILVARDYLGDEDFVMYLGDNILREGIVRH
KEHFEKSDYDASILLCEVPNPQQFGVAELSEDGKTIKRLVEKPKHPPSNLALVGIYFFRP
IIHEAVRHIKPSWRNELEITDAIQWLIDNGYKVGWTKVTGWWKDTGKPEDLLEANRLVLD
EIEKEVKVETRAKIIGRVKIEEGAQIDENSVIKGPAVIGKNAVIRNAYIGPYTSVGNNVV
IEDTEVEDSIVMDDSIIVGAGRIVESIIGRGVKIIKGNSHPMGRRLIIGDNSQIVL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggtggatacaatgaaagccctcatcctctcaggcggctatgggactcgattaaggccc
ttaacttactctcagcagaaacagttaattccggtagccaataagcctgtattgttttat
gcaattgaagatgtaattgaagctggtattcacgagattggaatagttgtcggacccaat
gctgatctagtgaagaagacagttatgagcgttgactgggatgccaatattgaattcatc
taccagggtgagccaaaggggttagcccatgcaatcctcgttgctagggattacttagga
gatgaagacttcgtcatgtacctaggggataacatcctaagagaaggaatagttaggcat
aaagagcactttgaaaagagtgattacgacgctagcattctcctctgtgaggttcctaat
ccccagcagtttggagttgccgagctcagcgaggatggaaagactataaagagactggta
gagaagccgaaacacccgccgagtaacttggccttggtaggtatctacttcttcagacca
ataatccatgaagcggtgaggcacataaagccctcatggaggaacgagctggagatcacg
gatgctattcaatggctaatcgataacgggtacaaggtggggtggacaaaggtaacgggc
tggtggaaggatactggaaagcctgaagatttgctcgaggctaataggctagtcttagat
gagatagagaaagaggttaaagtggagacaagggcgaagataattggtagggttaaaatt
gaagagggagcccaaatagacgagaattcagtaataaaaggcccggccgtgataggtaag
aatgccgtgataaggaacgcctatatcgggccttacacgagtgtaggaaacaatgtcgtg
attgaagatactgaggttgaggactcaatagtaatggatgacagtattatcgtaggagca
gggagaattgtggaaagcataatagggagaggagtaaagataataaaagggaacagccac
ccgatgggaagaaggctaattattggtgataactcgcaaatagtgctgtga

DBGET integrated database retrieval system