KEGG   Pyrococcus horikoshii: PH0414
Entry
PH0414            CDS       T00014                                 
Symbol
PH0414
Name
(GenBank) 336aa long hypothetical dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00521  Streptomycin biosynthesis
pho00523  Polyketide sugar unit biosynthesis
pho00525  Acarbose and validamycin biosynthesis
pho01100  Metabolic pathways
pho01110  Biosynthesis of secondary metabolites
pho01250  Biosynthesis of nucleotide sugars
Module
pho_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PH0414 (PH0414)
   01055 Biosynthesis of vancomycin group antibiotics
    PH0414 (PH0414)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PH0414 (PH0414)
   00525 Acarbose and validamycin biosynthesis
    PH0414 (PH0414)
Enzymes [BR:pho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     PH0414 (PH0414)
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 NAD_binding_10 adh_short NmrA KR Sacchrp_dh_NADP Statherin TrkA_N
Other DBs
NCBI-ProteinID: BAA29500
UniProt: O58151
Structure
Position
377637..378647
AA seq 336 aa
MHSMKLLVTGGMGFIGSNFIRYILEKHPDWEVINIDKLGYGSNPANLKDLEDDPRYTFVK
GDVADYELVKELVRKVDGVVHLAAESHVDRSISSPEIFLHSNVIGTYTLLESIRRENPEV
RFVHVSTDEVYGDILKGSFTENDRLMPSSPYSATKAASDMLVLGWTRTYNLNASITRCTN
NYGPYQFPEKLIPKTIIRASLGLKIPIYGTGKNVRDWLYVEDHVRAIELVLLKGESREIY
NISAGEEKTNLEVVKIILRLMGKGEELIELVEDRPGHDLRYSLDSWKITRDLKWRPKYTF
DEGIKKTIDWYLKNEWWWKPLVDERILHPTPWKLKW
NT seq 1011 nt   +upstreamnt  +downstreamnt
gtgcattcgatgaaactcttagtgactggaggaatggggttcattgggagcaacttcatc
cgctatatcctagaaaagcatccagactgggaagtaataaacatagacaagctaggatat
ggctcaaatccggctaacctaaaagatctggaagatgaccctaggtacaccttcgtgaaa
ggtgacgtagctgactacgagctcgttaaggaattggtgaggaaagttgatggggtagtg
cacctagcagcagagagtcacgtcgataggagcatttcttcgcctgaaatatttctccac
agcaacgttataggaacgtatactctcctcgagtcaataaggagagaaaaccccgaagtt
agatttgtacacgtgagtactgatgaagtctacggcgatattctgaagggttcatttacg
gaaaatgaccgtttaatgccctcctccccatattctgcgacgaaagcggccagcgatatg
ttagttctcgggtggacaaggacttacaacctgaatgcatcgataacgaggtgcacaaac
aactacggcccctatcaattcccggagaagctcattccaaagactataataagggcgagc
ttggggcttaagatacccatatatggtactgggaagaacgttagggattggctatatgtg
gaggatcacgttagagcaattgagcttgtcctgctcaaaggtgaatccagggagatatac
aatatctcagctggagaagagaagacaaacctggaagtagttaagattattttaaggctc
atgggcaaaggcgaggagttaatagagttagttgaggatagaccagggcatgacttacgc
tattccctggattcttggaagataaccagagacctaaagtggagaccaaagtacactttt
gatgagggaattaagaagaccattgattggtatttaaagaatgagtggtggtggaagcct
ttagttgatgagaggatactccacccaactccctggaaactaaaatggtag

DBGET integrated database retrieval system