KEGG   Pyrococcus horikoshii: PH0417
Entry
PH0417            CDS       T00014                                 
Symbol
PH0417
Name
(GenBank) 290aa long hypothetical dTDP-4-dehydrorhamnose reductase
  KO
K00067  dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00521  Streptomycin biosynthesis
pho00523  Polyketide sugar unit biosynthesis
pho01100  Metabolic pathways
pho01110  Biosynthesis of secondary metabolites
pho01250  Biosynthesis of nucleotide sugars
Module
pho_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PH0417 (PH0417)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PH0417 (PH0417)
Enzymes [BR:pho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     PH0417 (PH0417)
SSDB
Motif
Pfam: RmlD_sub_bind Epimerase GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_4 Semialdhyde_dh DapB_N
Other DBs
NCBI-ProteinID: BAA29503
UniProt: O58154
Position
379302..380174
AA seq 290 aa
MVAMRIAIIGANGQLGTDLVEVFGNDPEFEVVPLTHKDLDVTIPESLKVLKEIKPDVLIN
TAAYVRVDDAELYPEKAFAVNAIGALNVARIANEIDAVNVYISTDYVFDGEKGEPYTEED
VPNPINVYGVSKYTGEIFTRNYSPKHYIIRVASLYGKAGASGKGGNFVEWVIEKAKHGEE
LKIVDDQFMSPTYTKDVARTLKEFLKLRSEFGVYHMVNEGFCSWYEFTEAIFDVLGWNVE
IKPIKSNELNRLAKRPRFSALKNEKLEKIGLRMRHWREALEEYLKEKGYV
NT seq 873 nt   +upstreamnt  +downstreamnt
gtggttgcaatgagaattgcaataataggggcaaatgggcaattaggaactgatctcgtg
gaggtttttggtaatgatccagaattcgaagttgttccattaacgcataaagaccttgac
gttacaattccggagagtttgaaagtgctaaaagaaattaagccagatgtccttattaat
actgctgcttacgttagggttgatgatgcagagctttatcccgaaaaagcctttgccgtg
aatgcaattggtgctttgaatgttgcaaggattgccaatgagattgatgccgttaatgtt
tatatcagcacggattacgttttcgatggcgaaaagggggagccatataccgaagaagat
gtgccgaacccgataaatgtttatggtgtgagtaagtatacgggagaaattttcaccagg
aattattctcccaagcattacataattagggtggcgagcctctacgggaaggccggggcg
agcggtaagggcgggaactttgtggagtgggtgattgagaaggcaaagcatggagaagag
ctcaaaattgtggacgaccagttcatgagtccaacctataccaaagacgttgccagaact
ttgaaagagtttttaaagctgaggtcggagtttggggtttaccatatggttaatgagggc
ttttgctcgtggtacgagtttaccgaggcaatatttgatgttttaggctggaatgtcgag
ataaagcccataaagtcaaacgagctcaacaggctggcgaagaggccaaggttctctgcg
ctgaagaatgaaaagctggaaaaaattgggctaagaatgagacattggagagaagccttg
gaagagtatttaaaggagaagggttacgtgtag

DBGET integrated database retrieval system