KEGG   Pyrococcus horikoshii: PH0457Help
Entry
PH0457            CDS       T00014                                 

Gene name
PH0457
Definition
(GenBank) 653aa long hypothetical protein
  KO
K11389  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00010  Glycolysis / Gluconeogenesis
pho01100  Metabolic pathways
pho01120  Microbial metabolism in diverse environments
pho01200  Carbon metabolism
pho01230  Biosynthesis of amino acids
Module
pho_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pho_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH0457 (PH0457)
Enzymes [BR:pho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     PH0457 (PH0457)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C HHH_5
Motif
Other DBs
NCBI-ProteinID: BAA29543
UniProt: O58218
Position
417190..419151
Genome map
AA seq 653 aa AA seqDB search
MRFSVLKLDVEKKEVKLEDVDIPEVYGIIDYGIHIHNKLKTYEIEPYDPRNVVIIGKGPF
AGSALPGSHRLVFFYRSPLYGTLFPSTMGGASYQFQHVGVDFVEVHGRSEKPTVVIMKND
GENVSVSFYEIELEKVIEIWKGYKGEEGVYALTQYLLDNLSPEFEGMEFRIAVVGPASLN
TNYGAVFSQALRNGKRAIGSEDWAARGGTGSVLLRAHNVVGIAFGGKKRKKKFPGEDITN
MSTAKRIVEGVHKKPYNDVVTSATTKYRYNPKLRTGGTFGGNYPAEGELVPILNWQMPYI
PKEDRIKLHELIMKYYWEPFNKESIEPKNWTTCGEPCPAVCKKHRRGHHVEYEPYEANGP
LSGSISLYASDISVHAVDAMGFDAIEFGGTAAWIFELIHRGLLKPEEVGISDKPRFSKED
LMNDPEGTSEHNAKLVAELAHSVAFAKTEIAKIVGLGKRKASRILDEKFKDRLKYGESFK
DYAVYTPLGEDGEINPTMYWAIGNYIPLPIQGRYWTFYAFGTFLEPEELAEKIVSSALWE
FWYDNVGWCRFHRKWLKPTLKTLFMEAYGENVDMEEHAKKQIRRLIDYAKKAGYVPVFWD
SMRVIDLVSKGSEEFGNEKWSEKFRKDKIGTAKEYLKRVLEAYSLLMGTDWRI
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttttcggtattaaagctagacgttgaaaaaaaggaagtaaagcttgaagacgtc
gacattccagaggtgtatggtataatagactatggaattcacatccataataagttgaaa
acctatgagattgagccttacgatccaagaaacgtagtgataatcggaaagggcccattt
gcgggctccgcgttacctggatctcataggttagtgttcttctacagatctcccctttat
ggaactctgttcccctcaaccatgggaggagcgagctatcaatttcagcatgttggagtc
gacttcgtagaggtacatgggagatcagagaaaccaacagttgtgataatgaagaacgat
ggagaaaacgtaagcgtaagcttttatgagatagagctagaaaaggtaattgagatctgg
aaaggttataagggagaggagggggtttatgctctaacccaatacctccttgataacctt
tctccagagtttgaggggatggaatttaggattgcggttgttggtccagcttcgttgaat
accaattatggagctgtcttttctcaggccctaagaaacggaaagagggccattggaagt
gaggactgggctgcaaggggaggaacgggtagcgttctgctgagggcccacaacgtggtt
ggtatagcatttggggggaagaagagaaagaagaagttccctggggaggatataaccaat
atgtcaacggctaagaggatagttgagggtgtccacaagaagccttacaacgatgtcgtt
acaagcgcaacaacgaagtataggtacaatccaaagcttaggactggaggaacctttggt
ggaaactaccccgctgagggggaactggttccaattttgaactggcagatgccatacatt
ccgaaagaggataggatcaagttgcatgagttaataatgaagtactattgggaacctttc
aacaaagagtcgatcgagcccaagaactggacaacgtgcggtgaaccatgtcccgctgta
tgtaagaagcacaggagaggtcaccacgttgaatacgagccatatgaagcaaatggtccg
cttagcggtagtatctccctttacgcaagtgatattagcgttcatgcggttgatgccatg
ggtttcgacgcgatagaatttggaggaactgcagcatggatatttgagctcattcacagg
gggttgttaaagcctgaggaagttggaataagcgataagcctaggttcagtaaggaagat
ttaatgaacgatcctgaggggaccagcgagcacaatgctaagctagttgccgagttagct
cactcagtagcgtttgctaagactgaaattgctaagatagttgggcttgggaagaggaaa
gccagtagaatactggatgagaagtttaaggataggctaaagtacggggagagctttaag
gattacgctgtttatacccctctgggtgaggatggagagataaatccaacaatgtactgg
gctattggaaactacattccgcttccaattcaaggtaggtattggacgttctatgccttc
ggaacgttcctggaaccagaagagcttgctgaaaagatagtatcctctgccctctgggaa
ttctggtacgacaacgttgggtggtgcagattccataggaagtggctaaagcctaccctt
aaaactctattcatggaggcttatggtgagaacgtagatatggaggagcatgcgaagaag
cagatcaggaggctcatagattacgcaaagaaagctggctacgttccagtcttctgggat
agcatgagggttatcgacctggtctcaaagggaagtgaggaattcggtaacgagaaatgg
tccgagaagtttagaaaggataagatcggaacggccaaggaataccttaagagggtgcta
gaggcttacagcttattaatggggactgactggaggatttag

DBGET integrated database retrieval system