KEGG   Pyrococcus horikoshii: PH0482
Entry
PH0482            CDS       T00014                                 
Symbol
PH0482
Name
(GenBank) 120aa long hypothetical chemotaxis protein (cheY)
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
pho  Pyrococcus horikoshii
Pathway
pho02020  Two-component system
pho02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pho00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PH0482 (PH0482)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    PH0482 (PH0482)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pho02022]
    PH0482 (PH0482)
   02035 Bacterial motility proteins [BR:pho02035]
    PH0482 (PH0482)
Two-component system [BR:pho02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   PH0482 (PH0482)
Bacterial motility proteins [BR:pho02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PH0482 (PH0482)
SSDB
Motif
Pfam: Response_reg MTD B12-binding UPF0261 Glycos_transf_1
Other DBs
NCBI-ProteinID: BAA29570
UniProt: O58193
Structure
Position
439364..439726
AA seq 120 aa
MARVLVVDDAAFMRMLLKKILTQAGHEVVGEASNGKEAVEKYKQLKPDLVTMDIVMPEMD
GITAVKEIMKIDPNAKIIMITAVGQEAKVMEALKSGAKGYIVKPFQAQKVIEEVNRVLSS
NT seq 363 nt   +upstreamnt  +downstreamnt
atggctagagtattagttgtagatgacgcagctttcatgaggatgctacttaagaaaata
ctaacccaagcaggtcacgaagttgttggggaagctagtaatggtaaagaagccgtggaa
aaatacaagcaacttaaaccggacttagtcaccatggatatcgtcatgccagaaatggat
gggataacggccgttaaagagataatgaaaatagatcccaacgctaagataataatgatc
accgcagtagggcaggaagccaaggtaatggaagcccttaagagtggggccaaaggatac
atcgtaaaacccttccaagcccagaaggttatagaagaagtaaatagagtcctatcatcg
tag

DBGET integrated database retrieval system