KEGG   Pyrococcus horikoshii: PH0484
Entry
PH0484            CDS       T00014                                 
Symbol
PH0484
Name
(GenBank) 766aa long hypothetical histidine kinase (cheA)
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
pho  Pyrococcus horikoshii
Pathway
pho02020  Two-component system
pho02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pho00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PH0484 (PH0484)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    PH0484 (PH0484)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pho01001]
    PH0484 (PH0484)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pho02022]
    PH0484 (PH0484)
   02035 Bacterial motility proteins [BR:pho02035]
    PH0484 (PH0484)
Enzymes [BR:pho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PH0484 (PH0484)
Protein kinases [BR:pho01001]
 Histidine kinases
  CheA family [OT]
   PH0484 (PH0484)
Two-component system [BR:pho02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   PH0484 (PH0484)
Bacterial motility proteins [BR:pho02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PH0484 (PH0484)
SSDB
Motif
Pfam: P2 CheW Hpt HATPase_c H-kinase_dim HATPase_c_2 FtsX_ECD HATPase_c_3 HATPase_c_5 COMP
Other DBs
NCBI-ProteinID: BAA29572
UniProt: O58222
Position
440813..443113
AA seq 766 aa
MVTLEDMSQYLDEFLADARDRIDSLSNAILTLEKIVKEGGSEEEKTELINQIFRDAHTLK
GTAATMGFMKLSETAHKMENIFDAIRNSQLELTPELVDLVLDFLDAIDAMVNNIEESGNE
GDVDVSDLFERADEFLGGSKKEIKPEEKPKEAEKKEEKVAEEVPSAEGKVYYIKVKFQKD
APLKGVRAFLILSDLEERGEVIWTNPGREIIENGNLEGDVVEFRIVSETPKEELETVIKR
HPEVESVEIVEEKKKEEAGEKAVEGKEYVVRVYFQPDTPLKGPRSYLILNDLEKIGEILS
TNPSRQDIEEGNLIENKFFEVVLRTSESKEKISEILKKHPDVLNFTITEKEEEKKEEKKE
AKKQPPKQPKKPPIIETPKVKISRVIKIDVGHLDKLMNLVGELVITKGRLEQIGERLGDR
ELFEALSTLSRLLTELQDEIMEMRLTPIAEVFNKFPRMVRDLARKMGKEVEFVMEGADIE
VDRTILEKLGDALVHLLRNAVDHGIEPPEERVKLGKPRAGRVELIAKREKNHVVIIVRDD
GRGIDPEKVKRKAVERGLITPEEAANLSDEEAINLIFLPGFSTADKVTDVSGRGVGMDVV
KEVVKSMNGSISVQTEVGKGTTFILKLPISMAIIQALLIRVEDETYAIPINNILETIEVD
PSILKTVGGKPVIVLRGEIIPVIMLHELFGLPAPQVDRFPAIIVDHGAQKVAIGVDELLH
KRDIVIKSLGKFLSNVRGFAGATILGDGSVVLIIDIGGLLGGGYSG
NT seq 2301 nt   +upstreamnt  +downstreamnt
gtggtaaccttggaagacatgtcacaatatctagatgaatttttggccgatgcgagagac
agaattgatagtcttagcaatgcaatcctaactttagagaagattgtgaaagaagggggt
agtgaggaagaaaagactgaactaataaatcaaatatttagggatgctcatacgctaaag
ggaaccgctgcaactatggggtttatgaagcttagtgagaccgctcataagatggagaac
atctttgatgccataaggaattcccagttagagcttacccctgagcttgtcgatcttgtt
cttgattttctcgatgcgatcgatgccatggttaacaacatcgaagagagtggtaatgag
ggagatgtagatgtttctgatctatttgagagggccgacgaatttttaggcggaagtaaa
aaagagataaagcctgaagaaaagcctaaagaagctgaaaagaaagaagaaaaagtcgct
gaggaagttccgtccgctgaagggaaagtttattatataaaggttaagttccagaaggat
gctcctttaaagggtgttagagcttttctaatactctcagatcttgaggagagaggagaa
gttatttggacaaatcccggaagagagatcattgaaaatggtaatctagagggagatgtt
gttgaatttagaatagtgagtgagacacccaaggaagaacttgaaacagtcattaagagg
catcctgaagttgaatccgtagagatagttgaggagaagaaaaaagaggaagctggggag
aaagctgtagaaggtaaggaatacgttgtgagagtatacttccagcctgatactcctttg
aaaggccccagatcatatctaattcttaatgaccttgagaagataggcgagatcttatct
acaaatccaagtaggcaggatatagaagagggaaatctcatcgaaaataagttctttgaa
gttgtccttagaactagtgagagtaaagaaaagataagcgagatcttaaagaagcatccc
gatgttttaaacttcacgatcacggagaaggaagaggagaagaaggaggagaaaaaagaa
gcaaagaagcaacctcctaagcaacctaagaaacccccgataatagagactccaaaggtc
aagatttctagggtaatcaagatcgacgttggacacttggataagctaatgaacctagtt
ggagagctcgtcataacgaagggtaggcttgagcagataggggagagacttggagacagg
gaattatttgaggccctttcaacgttatcaaggcttctcacggagttacaagatgagata
atggaaatgagactaactccaattgccgaagtcttcaacaagttcccaaggatggtcagg
gatttagccaggaagatgggtaaggaagtggaattcgttatggaaggtgctgacatcgag
gttgataggacgatccttgagaagctcggtgatgcgctcgttcacctccttagaaatgcc
gtagatcatggaatagagccccccgaggagagggtaaagcttggtaagccgagagctggt
agagtggaactaatagcaaagagagagaagaaccatgtcgtaataatagttagggatgat
ggtaggggaatcgatcccgaaaaggtgaagaggaaagctgtggagaggggcctaataacc
ccggaggaggcagcaaatctaagtgatgaggaagctatcaacttgatattcctcccagga
ttcagcacggccgataaagttacggatgtatctggaagaggagttggaatggatgttgtg
aaggaagtcgtgaagtcaatgaacggttcaatctcagtccaaactgaggttggcaagggg
acaacgtttatacttaagctacccataagcatggcgataatccaggctttgctgataagg
gttgaggatgagacgtacgcgattccaataaataatatcctggagacaatagaggttgat
ccctcaattctcaaaacggtaggaggtaaacctgtcatagttctaaggggagagataatt
cccgtaataatgttgcatgagctctttggtttaccagctcctcaagttgatagatttcca
gctataatagtcgatcatggggcccagaaggttgcaataggggttgatgagctgttacat
aagagagatatagtgatcaagagccttggaaagttcctatcaaatgtcaggggctttgca
ggggctacaatacttggcgacggaagtgtagttctcatcatagacattggagggctgctt
ggaggtggatatagtggatga

DBGET integrated database retrieval system