KEGG   Pyrococcus horikoshii: PH0655Help
Entry
PH0655            CDS       T00014                                 

Gene name
PH0655
Definition
(GenBank) 348aa long hypothetical dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00260  Glycine, serine and threonine metabolism
pho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PH0655 (PH0655)
Enzymes [BR:pho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     PH0655 (PH0655)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: BAA29746
UniProt: O58389
Structure
PDB: 

Position
587615..588661
Genome map
AA seq 348 aa AA seqDB search
MSEKMVAIMKTKPGYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIK
PPQIMGHEVAGEVVEIGPGVEGIEVGDYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVD
TDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAVDTVLAGPISGKSVLITGAGPLG
LLGIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVMDITDGNGVDVF
LEFSGAPKALEQGLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKALTIYGITGRHLWETW
YTVSRLLQSGKLNLDPIITHKYKGFDKYEEAFELMRAGKTGKVVFMLK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaagatggtagctatcatgaagacaaagcctgggtatggtgctgagcttgtt
gaggtggacgttccaaagcctggacctggagaagttctcattaaggttcttgcaaccagc
atatgtggaactgatcttcatatatacgagtggaatgagtgggcacagagcaggattaag
ccacctcagataatggggcatgaagttgcgggagaagtcgttgaaatcgggccaggtgtg
gaaggaattgaagttggtgactacgtttccgttgaaacgcacatagtttgtggcaagtgt
tacgcctgcagaaggggccagtaccacgtctgccagaataccaagatatttggcgtcgat
acagatggcgtattcgcagagtatgccgttgttccagcccaaaatatctggaagaatcct
aaatcaattccaccagaatatgcaaccctccaggagcccttgggtaatgctgttgatacc
gttttggcaggaccaatttctggtaagagcgttttaataaccggagcggggccccttgga
ttattgggaattgcagtggcaaaagcgtctggcgcataccctgtgatagtctcagaacct
agtgacttcagaagggagttggccaagaaggtaggtgctgattacgttatcaatccattc
gaagaggatgtcgttaaggaggtaatggatatcacagatggaaatggtgttgacgtattt
ctggaattcagtggagctcctaaggctctagagcagggtcttcaagcagttacacctgct
ggaagggtatctctcctgggtctatacccaggaaaggttaccattgactttaacaatcta
ataatcttcaaggcgctaacaatctatggaataactggaaggcacctctgggaaacttgg
tatacagtttcaaggctccttcagagcggaaagctcaacttagatcctattataactcat
aaatataagggattcgacaagtacgaggaagcctttgagctaatgagggccggcaaaacg
ggtaaagttgtttttatgcttaaatga

DBGET integrated database retrieval system