KEGG   Pyrococcus horikoshii: PH0685Help
Entry
PH0685            CDS       T00014                                 

Gene name
PH0685
Definition
(GenBank) 334aa long hypothetical ferredoxin oxidoreductase beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00010  Glycolysis / Gluconeogenesis
pho00020  Citrate cycle (TCA cycle)
pho00620  Pyruvate metabolism
pho00640  Propanoate metabolism
pho00650  Butanoate metabolism
pho00680  Methane metabolism
pho00720  Carbon fixation pathways in prokaryotes
pho01100  Metabolic pathways
pho01120  Microbial metabolism in diverse environments
pho01130  Biosynthesis of antibiotics
pho01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH0685 (PH0685)
   00020 Citrate cycle (TCA cycle)
    PH0685 (PH0685)
   00620 Pyruvate metabolism
    PH0685 (PH0685)
   00640 Propanoate metabolism
    PH0685 (PH0685)
   00650 Butanoate metabolism
    PH0685 (PH0685)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PH0685 (PH0685)
   00680 Methane metabolism
    PH0685 (PH0685)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PH0685 (PH0685)
Enzymes [BR:pho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PH0685 (PH0685)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Glyoxalase_5 DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: BAA29776
UniProt: O58417
Position
608304..609308
Genome map
AA seq 334 aa AA seqDB search
MINMAVRKPPITTREYWAPGHAACAGCGCAIALKLATKAFSEAMEEKYGDPNAFAIAQAT
GCMEVVSAVFPYTAWKVPWIHVAFENAAAAASGVEAAWKKLGIKGKILAIGGDGGTADIG
LQALSGMLERGHNVVYLMYDNEAYMNTGIQRSSSTPYGAWTTTSPPGKYSIGEDRPKKWV
ALIAAAHQIPYAATASIGNPFDLVKKVKKAAKVDGPAFIQVHCTCPTGWRTPLEKGVEIA
RLAIETGMWPLFEIENGDIWNIKIQPPGGGAKVYKEGGRVVRIEFKKPIEEYLKYQGRFK
HLFKRPEAIEELRNQIKAMWKVLGVEAILPRPEE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgattaatatggccgttagaaagcctcccattactactcgtgaatattgggctcctggt
catgctgcatgtgctggttgtggatgtgctatagccctaaagttggcaaccaaagcattc
agcgaagctatggaagagaagtatggtgatccaaatgcattcgcaatcgctcaagccact
ggttgtatggaagtcgtctcagctgtattcccatacaccgcttggaaagttccatggatt
catgttgcatttgaaaatgccgctgcagcagcttctggagttgaagctgcatggaaaaag
cttggtataaagggtaagatactagccataggtggagacggaggtaccgcagatatagga
ttgcaggcactttccggaatgcttgagagaggccacaacgtcgtttacctcatgtacgat
aatgaggcttacatgaatactggaattcagaggtcttcatcaacaccctacggagcatgg
acaacgacttcacccccaggaaagtattccattggtgaggatagaccaaagaagtgggtt
gcgttaatagctgcggcccaccagataccttatgctgcaactgctagcattggtaatcca
ttcgatctagtgaagaaagttaaaaaagctgctaaggttgacggtccagcctttatacaa
gttcactgtacctgtccaacaggatggagaaccccacttgagaagggagttgagatagct
aggttagctattgaaaccggaatgtggccactctttgagattgaaaacggagatatatgg
aacataaagatacagcccccaggaggaggggccaaggtttacaaggaaggaggaagggtt
gtaaggatagagttcaagaaacccatagaggagtacctcaagtaccagggaagattcaag
cacctcttcaagagaccggaagcaattgaagaactcaggaatcaaataaaggccatgtgg
aaagtccttggagttgaggccattctcccaaggcctgaggagtga

DBGET integrated database retrieval system