KEGG   Pyrococcus horikoshii: PH0759Help
Entry
PH0759            CDS       T00014                                 

Gene name
PH0759
Definition
(GenBank) 390aa long hypothetical protein
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00010  Glycolysis / Gluconeogenesis
pho00030  Pentose phosphate pathway
pho00051  Fructose and mannose metabolism
pho00680  Methane metabolism
pho01100  Metabolic pathways
pho01110  Biosynthesis of secondary metabolites
pho01120  Microbial metabolism in diverse environments
pho01130  Biosynthesis of antibiotics
pho01200  Carbon metabolism
pho01230  Biosynthesis of amino acids
Module
pho_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH0759 (PH0759)
   00030 Pentose phosphate pathway
    PH0759 (PH0759)
   00051 Fructose and mannose metabolism
    PH0759 (PH0759)
  Energy metabolism
   00680 Methane metabolism
    PH0759 (PH0759)
Enzymes [BR:pho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PH0759 (PH0759)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PH0759 (PH0759)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: BAA29850
UniProt: O58501
Position
669143..670315
Genome map
AA seq 390 aa AA seqDB search
MVINSINWLFSEVVAMAVGEKITISVIKADVGGWPGHSRVHPALIEKAREVLSEAQKNGT
IIDFYVTYAGDDLQLIMTHKKGVDSPEVHGLAWEAFKKATEVAKELGLYGAGQDLLKDAF
SGNVRGLGPSVAEMEITLRKSEPIVTFHLDKTEPGAFNLPIFRMFADPFNTAGLVIDPKM
HMGFRFEIWDILEHKKVIMSSPEEMYDILALIGAKSRYVIKRVYPKEGHPVPKDEPVAVV
STEKLYEVAGEYVGKDDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPLMPVP
LKYATPTRFDGPPRAVALGWQISPEGKLIGPVDLFDDPAFDWARQKALEITDYIRRHGPF
EPHRLPSEEMEYTTLPGVLEKLKDRFEPIE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggttataaatagtataaattggcttttttcagaggtggttgcgatggccgttggtgag
aagataactataagcgttataaaggctgatgttggtggatggccgggacactccagagtt
catccagccctaattgaaaaggccagggaggttctttctgaagcccagaagaacgggacg
ataatagacttctacgtaacttacgctggagatgaccttcagctgatcatgacccataag
aagggtgtagacagccccgaggttcacgggttagcttgggaggcatttaagaaggctact
gaggttgctaaggagcttggtctttacggagctggtcaggacttgcttaaagatgccttt
agtggtaacgttagaggactgggaccaagcgttgctgagatggaaataaccttaagaaag
agcgagccaatagttaccttccacttagataagaccgagccgggagctttcaacctaccg
atctttaggatgtttgcagatccctttaatactgcagggttagtcatagatccaaagatg
cacatgggattcaggtttgagatctgggatattttagagcacaagaaggttataatgagc
tctccagaggaaatgtacgacatcttagccttaataggagccaagagcaggtacgttatc
aagagggtctatccaaaggagggccacccagtaccaaaggatgaaccagttgctgtagtc
tcaactgagaagctttatgaagttgcaggagagtacgtaggaaaagatgatcctgtagca
atagtaagagcccaaagtggccttccagccctgggagaagttctagaaccatttgcattc
ccacacttggttagtggatggatgagaggtagccacaacggcccactaatgccagttcct
ctaaagtatgcaacgccaacgagattcgatggaccacctagggccgtagctctaggatgg
cagataagcccggaaggaaagcttatcggacccgttgacctcttcgatgatcctgcattt
gattgggcgagacagaaggccctagagataactgattacataagaaggcatgggcctttc
gaaccacacaggctaccatctgaggaaatggagtacacaacccttccaggagttctagaa
aagttaaaggatagatttgagccgatagagtag

DBGET integrated database retrieval system