KEGG   Pyrococcus horikoshii: PH0925
Entry
PH0925            CDS       T00014                                 
Symbol
PH0925
Name
(GenBank) 464aa long hypothetical mannose-1-phosphate guanylyl transferase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00051  Fructose and mannose metabolism
pho00520  Amino sugar and nucleotide sugar metabolism
pho01100  Metabolic pathways
pho01110  Biosynthesis of secondary metabolites
pho01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PH0925 (PH0925)
   00520 Amino sugar and nucleotide sugar metabolism
    PH0925 (PH0925)
Enzymes [BR:pho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     PH0925 (PH0925)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     PH0925 (PH0925)
SSDB
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding Cupin_3 Cupin_6 CENP-C_C Cupin_1 Glyco_transf_8
Other DBs
NCBI-ProteinID: BAA30021
UniProt: O58649
Position
complement(833002..834396)
AA seq 464 aa
MKALILAGGKGTRLWPLSREAMPKQFIKVFSDRSLFQKTVERALIFSKPKEIFVVTNKEY
RFRVLDDLNELGLKVPEENILLEPVGKNTLPAIYWGLKVINDNYGDSVVAVLPSDHAIEV
NESYMEAFKKAEKLAEKYLVTFGIKPTKPHTGYGYIKPGEKIEVEGKVLGYLVDEFKEKP
DLETARKYVENGYYWNSGMFMFKVSVFMEEARKHSPDVVKAFEEGKSIEEIYELAPEISV
DYGIMEKTNKAAVVPLNTYWNDLGSFDAVYEALEKDENGNAVHVTGFKAKYINVDSRNNL
VLTERLTATVGVEDLVIIDTGDALLVAKRGETQKVKEVYKKLKEENDERAIVHRTAYRPW
GSYTVLEEGERYKIKRLTVLPGKRLSLQIHYHRSEHWVVVRGTAKVKVGDKEFILRPGES
TFIPAGVPHRLENPGKVILEVIETQIGEYLGEDDIVRLQDDYGR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgaaggctttgattctagctgggggaaagggaacgaggctctggcccctaagcagggaa
gcgatgcctaagcaattcattaaggttttctctgacaggtctttatttcaaaaaactgtt
gaaagggctttaatattttcaaaacccaaggaaatattcgtagttacaaacaaggaatat
agatttagagtcctggatgatttaaatgagctggggcttaaagtcccagaagagaatatt
ttgctcgagccggtaggtaagaatacgttaccggcaatatactgggggcttaaggttata
aacgataactacggggattccgtggttgcggttctacccagcgatcatgcaattgaagtc
aacgagagttatatggaagctttcaagaaggccgaaaagcttgctgagaagtatttagta
acgtttgggataaagcccacgaaaccccatacggggtatggatatataaaacctggggag
aaaattgaagtagaggggaaagttcttggctatcttgttgacgagttcaaggaaaaacct
gacttagaaaccgctaggaagtacgttgaaaacggctattactggaatagtggaatgttc
atgttcaaagtttccgtcttcatggaggaggccagaaagcattccccggatgtagtaaaa
gcttttgaggaaggaaagagcatcgaggagatctatgagctcgccccagagataagtgtt
gattatgggataatggagaagaccaataaagcagcggtagtccctttgaatacatattgg
aacgatctaggtagctttgatgctgtttacgaggccttagaaaaagatgaaaacggaaat
gcagttcatgttacaggatttaaagctaagtacataaacgttgattccaggaataacctg
gtactaacggagaggctaaccgctacagttggagttgaggatctcgtgataattgacact
ggagacgccctcttggttgcaaagaggggagaaactcagaaggttaaagaggtttacaag
aagctgaaggaggaaaacgacgagagggcaatagtccatagaacagcgtataggccctgg
gggagctacaccgttttagaggagggtgaaaggtacaagataaagaggttaacagtcctt
cccggaaaaaggttgagcttacagatccattatcacaggagcgagcactgggttgttgtt
aggggaactgctaaggtaaaagttggggacaaggagttcatcctaaggccaggagaaagc
accttcataccagccggagttcctcacagactcgaaaacccaggaaaagtgattctcgaa
gttatagaaacccaaataggcgaataccttggagaagacgacatagtaaggcttcaagac
gattacgggaggtga

DBGET integrated database retrieval system