KEGG   Pyrococcus horikoshii: PH0961Help
Entry
PH0961            CDS       T00014                                 

Gene name
PH0961
Definition
(GenBank) 275aa long hypothetical translation initiation factor eIF-2 alpha chain
  KO
K03237  translation initiation factor 2 subunit 1
Organism
pho  Pyrococcus horikoshii
Brite
KEGG Orthology (KO) [BR:pho00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pho03012]
    PH0961 (PH0961)
Translation factors [BR:pho03012]
 Eukaryotic Type
  Initiation factors
   eIF-2
    PH0961 (PH0961)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIF_2_alpha S1
Motif
Other DBs
NCBI-ProteinID: BAA30058
UniProt: O58655
Structure
PDB: 

Position
complement(875253..876080)
Genome map
AA seq 275 aa AA seqDB search
MPRKAREYPEEGEFVVATVKRIHNYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKE
GQKVVAKVIRVDPRKGHIDLSLRRVTQQQRKAKLQEFKRAQKAENLLRLAAEKLGKDFEA
AWREVWVPLEEEWGEVYAAFEDAAKDGIEVLKGHVPDEWLPVLKEIVENYVEVPTVTIDA
EFEITVPKPNGVEIIKEALIRARDRANKEKDIEVKFTYQGAPRYRIDITAPDYYKAEEVL
EDIAEEILRVIKQAGGEATLLRKEKRIRKVKKRKK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccaagaaaggccagggaatatccggaggagggtgagtttgtagtcgctactgtcaag
aggattcataattatggagcattcctcgagcttgatgagtatcctgggaaggaagcgttc
atgcacataagcgaagtggcctcgacgtgggttaggaacattagagactacctcaaagag
ggacagaaagttgttgccaaggttatcagggttgatccaaggaagggtcatatagatcta
agtctcagaagagttacacagcaacagaggaaggcaaagctacaggagtttaagagagct
cagaaagctgagaacttactaagactcgcagcggagaagcttggaaaagattttgaagct
gcgtggagggaggtttgggttccgctggaagaagaatggggagaggtctatgcagcgttt
gaagatgctgcaaaggatggaattgaagttttaaaaggtcatgttcctgatgaatggtta
cccgttcttaaggagatagtggagaactacgttgaggttccaactgtaactatagatgca
gaatttgagataaccgttccaaagccaaacggagttgagataataaaggaagctttgata
agggccagggatagagctaacaaggagaaagatattgaagttaagttcacatatcaagga
gcaccgaggtataggatagacatcacggccccagactactacaaggccgaagaagttctc
gaggatatagcggaggagatacttagggttataaagcaagcaggtggagaggcaactttg
ttgaggaaggagaagagaataaggaaggttaagaagagaaagaagtga

DBGET integrated database retrieval system