KEGG   Pyrococcus horikoshii: PH1072
Entry
PH1072            CDS       T00014                                 
Symbol
PH1072
Name
(GenBank) 342aa long hypothetical geranylgeranyl pyrophosphate synthetase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00900  Terpenoid backbone biosynthesis
pho01100  Metabolic pathways
pho01110  Biosynthesis of secondary metabolites
Module
pho_M00365  C10-C20 isoprenoid biosynthesis, archaea
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PH1072 (PH1072)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:pho01006]
    PH1072 (PH1072)
Enzymes [BR:pho01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     PH1072 (PH1072)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     PH1072 (PH1072)
    2.5.1.29  geranylgeranyl diphosphate synthase
     PH1072 (PH1072)
Prenyltransferases [BR:pho01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   PH1072 (PH1072)
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-ProteinID: BAA30171
UniProt: O58799
Structure
Position
977251..978279
AA seq 342 aa
MEKYEELFARIKEKAKLIDEKIFELIPEKDPRVLYEAARHYPLAGGKRVRPFVVLTSTEA
VGGDPLRAIYPAVAIELIHNYSLVHDDIMDMDETRRGKPTVHRIWGVNMAILAGDLLFSK
AFEAVARAEIPPEKKARVLEVIVKASNELCEGQARDLEFEKKSTVTIEEYMEMISGKTGA
LFEASAKVGGIIGTDNEEYIKALSSWGRNVGIAFQIWDDVLDLIADEKKLGKPVGSDIRK
GKKTLIVAHFFENADEKDKQRFLKIFGKYAGDVKGRGIIEEDIKSDVMEAIDLLKKYGSI
DYAAEIAKDMIKKANEALRILPKSKARMDLELLAKFIVEREY
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggagaaatatgaagaactatttgcaagaataaaagagaaggctaaactcatcgatgag
aagatcttcgagctcatcccggaaaaggatcccagagtcctctatgaggccgcaagacac
tatcctttagcaggtggaaagagggttagacccttcgttgttctaacgtcaactgaagct
gttggcggggatcctctaagggccatctatccagcggtggccattgagctaattcataat
tactccctggttcacgatgatataatggatatggatgaaaccagaaggggaaagccaact
gtgcatagaatttggggtgtaaacatggctattttagcaggagatctgctcttcagtaaa
gcctttgaagctgtggcaagggcggaaattcctccagaaaagaaagctagagtattagaa
gttattgtaaaggcgtcaaatgagctctgtgaaggccaagctagagatctagagttcgaa
aagaagagcacggtaactatagaagaatacatggaaatgataagcggaaagacgggggca
ttatttgaagcttcagcaaaagtcggaggcataatcggaacggacaacgaggagtatata
aaagccctttcaagttgggggagaaacgttggaattgcattccaaatttgggatgatgtt
cttgaccttattgccgatgagaaaaagctcggaaagcctgtgggtagtgacatcagaaag
gggaagaaaaccctgatagttgcccacttctttgagaacgcagatgaaaaggataagcag
aggttcctaaagattttcggaaagtatgctggtgatgttaaggggaggggaattattgag
gaagacatcaagtccgatgttatggaagctatcgatctacttaagaagtatgggagcata
gattatgcagcggaaattgctaaggatatgattaaaaaggcaaacgaagccctaagaatc
cttccgaaaagtaaggccagaatggatctagagttgcttgctaaattcattgtagaaaga
gaatactaa

DBGET integrated database retrieval system