KEGG   Pyrococcus horikoshii: PH1210
Entry
PH1210            CDS       T00014                                 
Symbol
PH1210
Name
(GenBank) 453aa long hypothetical phospho-sugar mutase
  KO
K03431  phosphoglucosamine mutase [EC:5.4.2.10]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00520  Amino sugar and nucleotide sugar metabolism
pho01100  Metabolic pathways
pho01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PH1210 (PH1210)
Enzymes [BR:pho01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.10  phosphoglucosamine mutase
     PH1210 (PH1210)
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF6802
Other DBs
NCBI-ProteinID: BAA30310
UniProt: O58973
Position
1089286..1090647
AA seq 453 aa
MRMGRYFGTSGIREVVNEKLTPELALKVGLALGTYLQEGKVVIGCDTRTSSVMLKNAVIS
GLLATGIDVIDIGLAPTPLTGFAIRLYNAEAGVTITASHNPPQYNGIKVWDRDGMAYTPD
KEHELEKIIESGNFRRVPWNEVGTLKTANPRKEYIEAILREINLKGSYTVVIDAGNGAGS
IVSPYLHRELGNRVITLNSDPSGFFVRELEPNKESLSMLEKTVKVLNADIGIAHDGDADR
VGVVDENGEFVEYEVMLSLIAGYMLKKYGKGKIVTTVDAGFALDDYIRELGGEVVRTRVG
DVAVAEELVKHGGVFGGEPSGTWIMPQWNLTPDGIFASALVLEMIDRLGPIGELAKDVPK
YVTLRKKIPCSNELKNKVMNKIADLIPREFSYERIITIDGIRIENDDWWILFRPSGTEPI
MRITLEAHTEEMAERLMKKAENLVKSVIKDLSS
NT seq 1362 nt   +upstreamnt  +downstreamnt
gtgagaatggggagatactttggaaccagtggaattagggaggtagttaatgaaaagtta
acccctgagttagctctaaaggttggtctagctttgggaacatacctccaggagggaaag
gtcgttatagggtgcgacactaggacgagtagcgtgatgcttaagaatgccgttataagt
ggactactagccacgggaatcgatgttatagatataggcctcgcacctaccccacttacg
ggatttgctataagattgtacaacgcagaggctggcgttacgataacagcatctcacaat
cctccacaatacaatgggatcaaagtttgggatagagatggaatggcatatactccggac
aaggagcacgaactcgagaagattatagaatccggaaactttagaagagtaccctggaac
gaggtaggaacattgaagacagcaaatcccaggaaagaatatattgaggctattttaaga
gaaataaatcttaagggatcctataccgttgttatagatgctgggaatggtgcaggttcg
atagtaagtccataccttcacagggaacttggaaacagggtgataacgcttaactccgat
cctagtggatttttcgttagagagcttgaaccaaataaggagagcctaagcatgcttgaa
aaaaccgttaaagtccttaacgcagatatcgggattgcacacgacggagatgcagacagg
gttggggtcgtcgatgagaacggagaattcgtagaatatgaggtcatgctctcgctaatt
gcaggttacatgctaaaaaagtatggaaaggggaagatcgtgacaacggtagacgctgga
tttgctttagacgattacatccgagaactaggaggagaagtcgttagaactagagttgga
gacgttgccgtcgctgaagagctagttaagcatggaggggttttcggtggggaaccttct
ggaacttggataatgcctcaatggaatctaaccccagatgggatattcgcaagcgctttg
gttttggagatgatcgatagattaggcccaattggagagttagcaaaggatgttccaaag
tacgtaaccctaagaaagaagatcccctgctcaaacgaactaaagaacaaggtcatgaat
aagatagccgatttaattccaagggagttctcctatgagaggataataacaattgatggt
ataaggatagagaatgacgactggtggattttgtttagacccagtggaacggagccgatc
atgaggatcacgcttgaggcccacacggaagagatggcagagaggctaatgaaaaaagct
gaaaatttagttaaaagcgtgataaaagatttatcttcttaa

DBGET integrated database retrieval system