KEGG   Pyrococcus horikoshii: PH1459
Entry
PH1459            CDS       T00014                                 
Symbol
PH1459
Name
(GenBank) 310aa long hypothetical fructokinase
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00051  Fructose and mannose metabolism
pho00500  Starch and sucrose metabolism
pho00520  Amino sugar and nucleotide sugar metabolism
pho01100  Metabolic pathways
pho01110  Biosynthesis of secondary metabolites
pho01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PH1459 (PH1459)
   00500 Starch and sucrose metabolism
    PH1459 (PH1459)
   00520 Amino sugar and nucleotide sugar metabolism
    PH1459 (PH1459)
Enzymes [BR:pho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     PH1459 (PH1459)
SSDB
Motif
Pfam: PfkB NanE
Other DBs
NCBI-ProteinID: BAA30566
UniProt: O59128
Structure
Position
complement(1307080..1308012)
AA seq 310 aa
MNLVFGMIASIGELLIDLISVEEGDLKDVRLFEKHPGGAPANVAVGVSRLGVKSSLISKV
GNDPFGEYLIEELSKENVDTRGIVKDEKKHTGIVFVQLKGASPSFLLYDDVAYFNMTLND
INWDIVEEAKIVNFGSVILARNPSRETVMKVIKKIKGSSLIAFDVNLRLDLWRGQEEEMI
KVLEESIKLADIVKASEEEVLYLENQGVEVKGSMLTAITLGPKGCRLIKNETVVDVPSYN
VNPLDTTGAGDAFMAALLVGILKLKGLDLLKLGKFANLVAALSTQKRGAWSTPRKDELLK
YKEAREVLAP
NT seq 933 nt   +upstreamnt  +downstreamnt
atgaatttggtgtttgggatgatagcttcaattggagagctcctaattgacttgatatct
gttgaagagggtgacttgaaggatgttaggctctttgaaaaacatcctggaggggcccca
gccaacgttgccgttggtgtttctagacttggggttaagtcttcccttataagtaaagtt
ggtaatgatcctttcggcgagtacttaattgaagaattatctaaagaaaacgtggataca
aggggaatagtaaaagatgagaaaaaacatactggaatagtgttcgtccagctaaagggt
gcgtctcctagctttttattgtatgatgatgtcgcctatttcaacatgaccctgaatgat
atcaactgggatattgtggaggaagctaagatcgtaaattttggatctgtaattctagct
aggaatccaagcagggagacagtaatgaaggtcattaagaagataaaagggtcttctctc
atagcttttgatgtaaatttaaggctggatttatggagaggacaagaagaggaaatgata
aaagtgcttgaggaatcaataaagctagcagacattgtaaaggccagtgaagaggaagtc
ttatacctagagaaccaaggggttgaggtcaagggaagtatgctgacggccataaccctg
ggtcctaagggatgtaggttaataaagaatgaaacagtcgttgatgttccttcctataat
gttaatcccctcgacacgactggagcgggagatgcattcatggccgctttacttgtcgga
attctaaagttgaaagggcttgatctattaaaactcggtaaatttgcaaaccttgttgct
gctttgtcaactcaaaaacggggggcgtggagcactccaagaaaagatgaactattaaaa
tataaagaggcgagggaagttctagctccttga

DBGET integrated database retrieval system