KEGG   Pyrococcus horikoshii: PH1887Help
Entry
PH1887            CDS       T00014                                 

Gene name
PH1887
Definition
(GenBank) 206aa long hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
pho  Pyrococcus horikoshii
Brite
KEGG Orthology (KO) [BR:pho00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pho03016]
    PH1887 (PH1887)
Enzymes [BR:pho01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     PH1887 (PH1887)
Transfer RNA biogenesis [BR:pho03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    PH1887 (PH1887)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-ProteinID: BAA31009
UniProt: O59533
Position
1640542..1641162
Genome map
AA seq 206 aa AA seqDB search
MKAKREALISLFHAIKEEKVDSDIIDLLLLINSIKGIYTTSSCSGRIGILEEPSLGAKPL
SRWLIKVHRPMSFEEARDALKRAREGLIFLKSQPPIFHVVAETIENAKLVHEIGLASGFK
YTTFKAISSRFLVEINGTEYLTVPLGKDGRIIASDEYLKFAISIGNKMLERGKSKLPRLR
DNFEKIKKKLGEDPLFIQLKREILEI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccaaaagggaagcattaataagcttatttcatgcaatcaaggaagaaaaagtt
gatagtgacataattgaccttttacttctaattaattcaataaaaggaatatatacaact
tcctcttgttcaggtagaataggaatacttgaagaaccctcccttggagcaaagcccctc
tccaggtggttaataaaagttcacagacccatgagctttgaagaggcaagggatgcctta
aaaagggctagagaagggttaatattcttaaagagtcaacctcccatatttcacgttgtt
gctgagacgattgaaaatgctaagcttgttcacgaaatcggacttgcaagtggattcaag
tatacaacgtttaaggccatatcctcaagattcctggtggagataaacggaaccgaatac
ctaacggttcccctgggaaaagatggaaggattatagctagcgatgagtatcttaagttc
gcaatctccattggaaataagatgttagagaggggtaagtcaaaacttccaaggcttagg
gataactttgaaaagattaagaaaaagcttggagaggatcctcttttcattcagttgaaa
agggagatacttgagatttaa

DBGET integrated database retrieval system