KEGG   Phaeobacter porticola: PhaeoP97_01375Help
Entry
PhaeoP97_01375    CDS       T04595                                 

Gene name
dltA2
Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase subunit
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
php  Phaeobacter porticola
Pathway
php00473  D-Alanine metabolism
php01100  Metabolic pathways
php01503  Cationic antimicrobial peptide (CAMP) resistance
php02020  Two-component system
Brite
KEGG Orthology (KO) [BR:php00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PhaeoP97_01375 (dltA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PhaeoP97_01375 (dltA2)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    PhaeoP97_01375 (dltA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:php01504]
    PhaeoP97_01375 (dltA2)
Enzymes [BR:php01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     PhaeoP97_01375 (dltA2)
Antimicrobial resistance genes [BR:php01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    PhaeoP97_01375 (dltA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: APG46798
UniProt: A0A1L3I3V1
Position
1391364..1392923
Genome map
AA seq 519 aa AA seqDB search
MFETFIADLRETLLSQPDRPALITSEEVISFGSLARRVEGILRALDDMPPGLSLIVGHKE
PDCIAAMIACAIAGRAFAFADRSTPMDRLEQIASTAAASHILAFGQETLLGGLPVQTLKD
LPTRTPQLELGAALSEEGPFYVIFTSGSTGTPKGVPISRGNYMALHRWYTPLLGAVRPEG
AHVNHASMAFDMGMFDLWPTLSLGRPVHLLNHANNIMPRNNIRHLTRVDVASPASWASTP
SLLQLMCTDPQFTAENLPDLRFFVVGGEMLPGALVQELQTRFPQAQVLNGYGPSEATCAT
HLYPISVADAGADGAMKIGCAVGENRMQIIDADGEDVPAGEQGELVLSGPQVISHYLPRD
HPANAALNQEDGINTYRTGDLARLDVDGNLILLGRIDRQVKLLGNRIELNEIERIAEGYS
AVRKAVCLPQKDAADRVTGLQLFVEPLAGATCERDGLFAHMGKHLSAQVLPRDLRIVSAF
PVTSNGKLDTRSLLELPTARTPSRGIAASDTGLMAEAVK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagacatttattgcagacctccgtgaaaccctgctctcgcaaccggaccgcccg
gcattgatcacctctgaggaggtgatcagttttggcagcttggctcgccgggttgaaggc
atcctgcgcgcgctcgacgatatgccgccggggctcagcctgattgtcggtcataaggaa
ccggattgcattgccgcgatgattgcctgcgccattgctgggcgcgcttttgcctttgcc
gaccgctccacgccgatggaccgcttggaacagatcgccagcaccgccgcggccagtcat
atcttggcctttggccaggaaactctgctaggtggtttgccggtccagacgctaaaggac
ctgccgacacgcacgcctcagctggaattgggagctgcgctctctgaggagggacccttc
tatgtgattttcacctccggcagcaccggcacgccaaagggggtgccgatttcacggggc
aactatatggcgctgcaccgttggtatacgccgctactgggggctgtcagaccggagggg
gcgcatgtgaaccatgccagcatggcctttgacatgggcatgtttgatctctggccaacc
ctgtctctggggcgtcctgtgcatttgctcaaccatgcaaacaacattatgccccgcaac
aacatccgtcatctgacccgcgttgatgtggcctctccggcgtcttgggcgtcgacccct
tcgctgttgcaattgatgtgcacggacccgcagttcaccgctgaaaacctgccggatctg
cgctttttcgtggtcggcggtgagatgctgccgggtgcgctggtccaggaactacagacc
cgctttccgcaggctcaggtgctgaatggctatggcccgtccgaggcgacttgtgcgacg
catctctacccgatcagcgtcgcagatgctggtgcagatggcgcgatgaaaatcggctgc
gcggttggggaaaaccggatgcagatcatcgacgcagacggtgaagacgttcccgcaggc
gagcaaggcgagctggtcttgtccggcccgcaggttatcagccactatttgcctcgggat
caccccgccaatgccgcacttaaccaagaggacggcatcaatacctatcgcaccggtgat
ctcgcccgtcttgatgtggatggaaatctgatcctgctgggccggatcgaccggcaggtc
aaacttctgggcaaccggatagaattgaacgaaatcgagcgtatcgcagaaggctactca
gctgtacgcaaagctgtctgcctgccgcaaaaagacgccgccgaccgcgtcaccgggttg
cagctctttgtagagcctctggccggggccacctgtgaacgggatggcttgtttgcccat
atgggcaaacatctctcggcgcaggtgctaccgcgtgatctgcggattgtgtcggctttt
ccggtgaccagcaatggcaagctggacacgcgcagcctgctggagctgccgactgcacgg
accccctcgcgcggcatcgcggcatctgacacgggtttgatggcggaggctgtgaaatga

DBGET integrated database retrieval system