KEGG   Phaeobacter porticola: PhaeoP97_01645Help
Entry
PhaeoP97_01645    CDS       T04595                                 

Gene name
arcA
Definition
(GenBank) arginase ArcA
  KO
K01476  arginase [EC:3.5.3.1]
Organism
php  Phaeobacter porticola
Pathway
php00220  Arginine biosynthesis
php00330  Arginine and proline metabolism
php01100  Metabolic pathways
php01110  Biosynthesis of secondary metabolites
php01130  Biosynthesis of antibiotics
php01230  Biosynthesis of amino acids
Module
php_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:php00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PhaeoP97_01645 (arcA)
   00330 Arginine and proline metabolism
    PhaeoP97_01645 (arcA)
Enzymes [BR:php01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PhaeoP97_01645 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: APG47062
UniProt: A0A1L3I4X1
Position
1674149..1675075
Genome map
AA seq 308 aa AA seqDB search
MTSKTCILIGAPVDSGKRRAGCLMGPDAYRTAGLGRAIESLGHKVIDQGNLRPATHEPDT
NDGLVFARNETIGWTNRLIRAAEEAMTKGLPIFLGGDHSLSLGSVVGVANHAAKEGRPQF
VLWLDAHTDFHTPATSDSGNLHGTPVGYFTGRPDFAGFPEVANPVPQENVCMIGLRSVDT
PERLALEASDIHRHDMRDIDENGIAGPLSAFLQRVKDANGMLHVSLDVDFLDPSVAPAVG
TTVPGGATVREGHLVCEMLHDSGLMTSLDLVELNPFLDERGRTAHLMVDLCASALGRRVF
DRPTRSYQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgacatccaagacctgtattctgatcggcgccccggtggacagcggcaagcgacgcgcc
ggatgcctgatggggccggatgcctatcgcaccgccggtctggggcgcgcaatcgaaagt
ctgggtcataaggtgatcgatcagggcaatttgcgtcctgccacccatgaacctgatacc
aacgacggtctggtctttgcccgcaatgaaacgatcggctggaccaatcgtctgatccgc
gccgcggaagaggcgatgacaaaagggctaccgatcttccttggtggcgaccattcgctg
tccttgggttcggttgttggcgtggccaaccacgcggccaaggaaggccgcccgcaattc
gtgctgtggctcgatgcgcataccgattttcacaccccggcgacctctgacagcggcaac
ctgcacggcacaccagtgggctatttcaccgggcgccctgatttcgcaggctttcccgag
gttgccaatccggtcccgcaagaaaacgtctgcatgattggcctgcgttccgtggacacc
ccggaacgcctcgcgcttgaggccagcgatattcatcgtcatgacatgcgtgatatcgat
gaaaatggcattgccggtccgctttctgcctttcttcagcgggtcaaggatgccaacgga
atgctgcatgtttcgctggatgttgattttctggacccgtctgtggcccctgcggtcggc
accaccgtgcccggcggcgccacagtgcgcgaggggcatttggtgtgcgaaatgctgcac
gattccgggctgatgacctcgctcgaccttgttgagctgaacccgtttctggatgagcgg
ggccgcacggcccatctgatggtggatctctgcgcctcagcccttgggcgtcgtgtcttt
gaccgcccgacacggagctatcaatga

DBGET integrated database retrieval system