KEGG   Phaeobacter porticola: PhaeoP97_02371Help
Entry
PhaeoP97_02371    CDS       T04595                                 

Gene name
ltaE
Definition
(GenBank) low specificity L-threonine aldolase LtaE
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
php  Phaeobacter porticola
Pathway
php00260  Glycine, serine and threonine metabolism
php01100  Metabolic pathways
php01110  Biosynthesis of secondary metabolites
php01120  Microbial metabolism in diverse environments
php01130  Biosynthesis of antibiotics
php01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:php00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PhaeoP97_02371 (ltaE)
Enzymes [BR:php01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PhaeoP97_02371 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Pyridoxal_deC NIR_SIR_ferr MGC-24 ELFV_dehydrog_N
Motif
Other DBs
NCBI-ProteinID: APG47765
UniProt: A0A1L3I6P8
Position
2434928..2435962
Genome map
AA seq 344 aa AA seqDB search
MHFASDNSGPANPEILAALAAANTGYAMGYGADLEMAKVTARIREIFEAPEAAVYLVATG
TAANVLALSTLSQPWQTLFCSAPAHINMDECNAPEFYTGGAKLTLVTGNDKMTPDDLRAA
VEGEETRGVHGPQRGPVSITQVTEFGTIYSLDELRALCDVAKSYGLPVHLDGARFTNAMV
SLACTPAEMTWKAGVDAVSFGGTKNGCLGVEAVIFFDPAKAQEFEYRRKRGAHLFSKHRY
LSAQMFAYLSDDLWLSNARTANAKAARLAEGLHSAGATFSHTPQANMIFAALPRATHQKL
FDAGAIYHLWDGGLEGPPEEEITARFVCDWSISNDEIDAFVALI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcattttgcctctgacaactccggcccggccaatcctgaaatcctcgcggcccttgcg
gcggcgaatacaggctatgccatgggttatggtgcggatcttgaaatggcaaaggtcacc
gcccgcattcgcgagatctttgaagcaccggaagccgcggtctatctggtcgccacgggc
accgcggccaatgtgctggcgctgtcaacactgtcgcaaccgtggcagacactgttttgc
agcgcccccgcccatatcaatatggacgaatgcaacgcgccggagttctacaccggcggc
gcaaagctgacactggtcaccggcaacgacaaaatgaccccggatgatctgcgcgcggca
gtcgagggcgaggaaacccgtggtgtgcacggtccccagcgcggcccggtgtcgatcacc
caggttacggaattcggcacgatctattcgctggacgaactccgcgcgctttgtgacgtg
gcaaaatcctacgggctgcctgttcatctggatggagcccgctttaccaatgccatggtt
tcgctcgcctgcactccggcggagatgacctggaaggctggcgtggatgcggtgtccttt
ggcggcacaaaaaatggctgcttgggggttgaggcggtgatcttctttgatccggccaag
gcacaggaatttgagtaccgccgcaaacgtggcgcgcatctgttctctaaacaccggtac
ctgtcggcgcagatgttcgcctatctcagtgatgatctctggctgagcaatgcccgcaca
gccaatgccaaagccgcacgtctggccgaggggttgcacagtgcgggggccacgttcagt
catacgccacaggcaaatatgatctttgcagcgctgccccgagccacccatcagaagctg
tttgatgcgggcgcgatctaccatctttgggatggcggccttgagggaccgcctgaagaa
gaaatcacagcacggtttgtctgtgactggtcgatcagcaacgatgagatcgacgccttt
gtggcgctaatctaa

DBGET integrated database retrieval system