KEGG   Phaeobacter porticola: PhaeoP97_03514Help
Entry
PhaeoP97_03514    CDS       T04595                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
php  Phaeobacter porticola
Pathway
php00071  Fatty acid degradation
php00072  Synthesis and degradation of ketone bodies
php00280  Valine, leucine and isoleucine degradation
php00310  Lysine degradation
php00362  Benzoate degradation
php00380  Tryptophan metabolism
php00620  Pyruvate metabolism
php00630  Glyoxylate and dicarboxylate metabolism
php00640  Propanoate metabolism
php00650  Butanoate metabolism
php00900  Terpenoid backbone biosynthesis
php01100  Metabolic pathways
php01110  Biosynthesis of secondary metabolites
php01120  Microbial metabolism in diverse environments
php01130  Biosynthesis of antibiotics
php01200  Carbon metabolism
php01212  Fatty acid metabolism
php02020  Two-component system
Brite
KEGG Orthology (KO) [BR:php00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PhaeoP97_03514
   00630 Glyoxylate and dicarboxylate metabolism
    PhaeoP97_03514
   00640 Propanoate metabolism
    PhaeoP97_03514
   00650 Butanoate metabolism
    PhaeoP97_03514
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PhaeoP97_03514
   00072 Synthesis and degradation of ketone bodies
    PhaeoP97_03514
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PhaeoP97_03514
   00310 Lysine degradation
    PhaeoP97_03514
   00380 Tryptophan metabolism
    PhaeoP97_03514
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PhaeoP97_03514
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PhaeoP97_03514
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PhaeoP97_03514
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:php04147]
    PhaeoP97_03514
Enzymes [BR:php01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PhaeoP97_03514
Exosome [BR:php04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PhaeoP97_03514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APG48867
UniProt: A0A1L3I9N6
Position
complement(3608693..3609868)
Genome map
AA seq 391 aa AA seqDB search
MTDIVILDGARTAIGTFGGALAGTPPIDLATTVSKAAMERSGIDPEQIGNVVFGHVINTE
PRDMYLSRVAAMQAGVPNGTPAMNVNRLCGSGAQAIVSGIQSLMLGDAEFALTGGAENMS
RSPFIVPSARWGQKMGDARALDMMLGALNCPFGTGHMGVTAENVADEHDITRAQMDEFAL
ASQTRAAAAIEAGYFASQIIPIEVKVKRDMVPFDVDEHPKASTLDTLSGLKPVFKKDGRV
TAGNASGINDGAAAIVMATADAAQKAGLKPKARILGYAHAGVRPEVMGIGPVPAVQNLLK
KTGLSASDFDVIESNEAFAAQALAVNKELGLDPAKVNPNGGAIALGHPVGATGAIITLKT
LYELERTGGSKGLITMCIGGGQGIALAIELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactgatatcgtgatcctggatggcgctcgtaccgccattggtacttttggcggtgcg
ctggctggcacccccccaatcgaccttgcgacaactgtgtccaaggccgcgatggaacgt
tccggtatcgaccccgaacaaatcggcaatgtggtctttggccatgtgatcaacaccgag
ccccgcgacatgtacctgagccgcgtggcggcgatgcaggctggcgtccccaacggcacg
ccagcgatgaacgtcaaccggctttgtggatctggcgcgcaggcgattgtctccggcatc
cagtccctcatgctgggcgatgcggaatttgcccttaccggtggtgccgaaaacatgtcg
cgcagcccctttatcgtgccaagcgcccgctggggtcaaaaaatgggtgacgcccgcgca
ttggacatgatgctgggggcgctgaattgtccctttggcaccggccatatgggagtcacc
gcagagaatgtcgcggatgaacatgatatcacccgtgcacagatggatgaatttgccctc
gccagccagacccgcgctgctgcggcgatcgaggccggatacttcgcgagccagatcatc
ccgattgaggtgaaggtaaagcgggacatggttccgtttgacgtcgatgaacaccccaag
gccagcacgcttgacaccctcagcgggctgaaacccgtgttcaaaaaagatggccgcgtc
actgccggcaatgccagcggtatcaatgatggcgccgccgctatcgtcatggccaccgcc
gatgccgcgcagaaggctggactaaaacccaaagcgcgcattttgggctacgcgcatgcc
ggtgtccgccccgaagtcatgggcattggcccggttcccgcagtgcagaaccttctgaag
aaaaccggactgtctgcctccgattttgacgtcatcgaatccaacgaggcgtttgccgcg
caagcactggccgtgaacaaggaactggggctcgaccctgcgaaggtgaacccgaatggc
ggcgcaatcgcattgggccatcccgtaggcgcgactggtgcgattatcacactgaaaaca
ctttatgaattggagcgcaccggcggctccaaaggcctcatcactatgtgcatcggcggc
ggtcagggcatcgcactggcgatagaactgctctga

DBGET integrated database retrieval system