KEGG   Phaeobacter sp. LSS9: D1820_04100Help
Entry
D1820_04100       CDS       T05617                                 

Definition
(GenBank) class II aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
phq  Phaeobacter sp. LSS9
Pathway
phq00051  Fructose and mannose metabolism
phq01100  Metabolic pathways
phq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:phq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    D1820_04100
Enzymes [BR:phq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     D1820_04100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AXT34222
Position
839081..839752
Genome map
AA seq 223 aa AA seqDB search
MPSSAPEDSPALRQSIIDACLEMNRSGINQGTSGNISLRIADGDMLITPSGVPYKAMTPE
MIVRMPLDRGPDAGDGQPAPSSEWQFHQALLAAKPEAMAVVHAHPVNCCALAVNHMAIPA
CHYMVAAFGGHDVPLADYALFGSSELSAHVIAAMADREGCLMANHGAICTGDTLARAMWR
MAELEHLAATYIRARSIGTPELLSPAQIDDALAAFAGYGLKQD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgccaagctccgcccctgaggatagcccggcgctgcgccagtcgatcattgacgcctgt
ctggagatgaacaggagcggcatcaatcagggcacatccggcaatatctcgctgcggatc
gccgacggggacatgctgatcaccccatccggtgtcccctataaggcaatgaccccggag
atgattgtgcggatgccgctggatcgcggaccggatgcgggggacggccagcctgcgccc
tcctcggagtggcagttccatcaggcgctgctcgcagccaagccggaggcgatggccgtg
gttcatgcccatcctgtcaattgctgtgcgcttgccgtgaaccacatggcgatcccggcc
tgtcattatatggtggcggcgtttggcggacatgatgttccgctcgctgattatgcgctt
tttggcagttcggagctgtcggcccatgtgatcgcggccatggcggaccgcgaggggtgc
ctgatggcgaaccatggcgccatctgcaccggtgacaccctggcgcgcgccatgtggcgg
atggctgagctggaacatttggcagcaacctacattcgcgcccgcagcatcggcacgccc
gagctgctcagcccggcgcagatcgacgacgcgctggcggcatttgcaggctatgggttg
aagcaggactaa

DBGET integrated database retrieval system