KEGG   Phaeobacter sp. LSS9: D1820_11110Help
Entry
D1820_11110       CDS       T05617                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
phq  Phaeobacter sp. LSS9
Pathway
phq00061  Fatty acid biosynthesis
phq00071  Fatty acid degradation
phq01100  Metabolic pathways
phq01212  Fatty acid metabolism
phq02024  Quorum sensing
Module
phq_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:phq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    D1820_11110
   00071 Fatty acid degradation
    D1820_11110
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    D1820_11110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:phq01004]
    D1820_11110
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phq04147]
    D1820_11110
Enzymes [BR:phq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     D1820_11110
Lipid biosynthesis proteins [BR:phq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   D1820_11110
Exosome [BR:phq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   D1820_11110
  Exosomal proteins of breast cancer cells
   D1820_11110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding YwhD
Motif
Other DBs
NCBI-ProteinID: AXT36770
Position
complement(2303323..2305266)
Genome map
AA seq 647 aa AA seqDB search
MMSLPALLERNAAQIGDRQAYREKEFGIWQCWTWSETQKEIEALALGLINLGVNEGDFIA
IIGRNRPSLYWAMVAAQSVGAVPVPLYQDAVAEEMSYVLDHCGARFVIAGDQEQVDKVLE
VQEQLSNLEQIIYLDPRGMRKYDHHTLHEYAHVQEQGRAARDEWTPDLEARKAKLTYDST
CVMLYTSGTTGKPKGVVLSNRNVIESAKNSAEFDKLTAGENILSYLPMAWVGDFIFSVGQ
AYWCGFCVNCPESADTMMTDLREIGPTYFFAPPRVFEGQLTSVMIRMEDASTLKRKMFHH
FLAHAKKVGGDILDGRPVGLMDRLKYKLGDLLVYGPLKDTLGYGRIRVGYTAGEAIGPEI
FDFYRSLGINLKQLYGQTEATVFITVQPDGEVRADTVGVPAPDVEIKIADNGEIFYRSPG
TFVEYYKNPESTASTKDPEGWVATGDAGFFEEGSGHLRIIDRAKDVGKMADGAMFAPKYV
ENKLKFYPDILEVVLFGNDRDRCVAFINIDLTAVGNWAERNNIAYASYQELAGHPKVLQS
IREHVETVNESVAQDVMLSGCQVHRFVVLHKELDADDGEMTRTRKVRRVVVEDKYSDIIT
ALYDGSSQISTRTEVTYEDGRKGEISATLDIIDAKVVPVTPQAVAAE
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccctgccggcgctgcttgaacgcaatgcggcacagattggtgaccgccaagcc
tatcgggaaaaggaattcggcatttggcaatgctggacctggtccgagacccagaaggaa
atcgaggcgcttgcgcttgggttgatcaacctcggggttaacgagggagatttcatcgcc
atcatcggacgcaaccgtccatcgctgtactgggcgatggttgcggcgcaatcggtgggc
gcggttccggtgcctctctatcaggacgcggtcgctgaagagatgtcctatgtccttgat
cactgtggcgcacggttcgtcatcgccggtgatcaggagcaggtggacaaggtgctcgag
gttcaggagcagctgagcaatctggagcagatcatctatctggatccgcgcggcatgcgc
aaatatgaccaccatacgctgcatgaatatgcccatgtgcaggagcagggccgggccgcg
cgcgacgaatggacgcctgatctggaagcccgcaaggccaagctgacctacgacagcacc
tgcgtgatgctctatacgtccggcaccacaggcaagcccaagggggttgttctgtccaat
cgcaatgtgatcgaaagcgccaagaactctgcggagtttgacaagctgacggcaggcgag
aatatcctgtcatatctgccgatggcctgggttggcgatttcatcttctcggtcgggcag
gcctattggtgcggcttctgtgtgaactgcccggagagcgccgacaccatgatgacggat
ctgcgcgaaatcgggccaacctatttcttcgcgccgccgcgtgttttcgaaggtcagctg
accagcgtcatgatccgtatggaggacgccagcacgctgaagcgcaagatgttccaccac
ttccttgcgcatgccaagaaggtcggcggtgacattctggatggtcgcccggttgggctg
atggaccggctgaagtacaagctgggggatcttctggtctatggtccgctgaaggatacg
ctgggctatggccgtattcgcgttggctacaccgccggtgaggcgatcgggccggaaatc
ttcgatttttaccgcagcttgggcatcaacctgaaacagctctacggccagaccgaagcg
acggtgttcatcaccgtgcaacccgatggcgaggtgcgcgctgatactgtgggggttccg
gcccctgatgtggaaatcaagatcgcggacaatggcgagattttctatcgctctcccgga
acctttgtcgaatattacaaaaacccggaatccacggcttcgaccaaggatcccgagggc
tgggtcgccacgggggatgccggattctttgaagagggcagcggccaccttcggatcatc
gaccgtgccaaggatgttggcaaaatggcggacggcgcgatgtttgcgcccaaatacgtc
gagaacaagctgaagttctatccggacattctggaagttgtgctgttcggcaatgaccga
gaccgctgtgtcgcctttatcaacatcgacctgacggcagttggcaactgggcggagcgg
aacaacatcgcctatgcctcctatcaggagctggcggggcatcccaaggtgctgcaatcg
atcagggaacatgtcgaaaccgtcaacgagtcggtggcacaggatgtcatgctctcgggg
tgtcaggtgcaccgctttgtcgtgctccacaaagagctggacgctgacgatggcgagatg
acccggacccgcaaggtgcgccgtgtggtggtcgaggacaagtattccgacattatcaca
gcgctttacgatggatcctcgcagatttcgacacgtacggaagtgacctatgaggatggc
cgcaagggtgagatcagcgccacgctggatatcattgatgccaaggtcgtgccggttacc
ccacaagcggtggctgcggaatga

DBGET integrated database retrieval system