KEGG   Phaeobacter sp. LSS9: D1820_13830Help
Entry
D1820_13830       CDS       T05617                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
phq  Phaeobacter sp. LSS9
Pathway
phq00350  Tyrosine metabolism
phq00360  Phenylalanine metabolism
phq00380  Tryptophan metabolism
phq01100  Metabolic pathways
phq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    D1820_13830
   00360 Phenylalanine metabolism
    D1820_13830
   00380 Tryptophan metabolism
    D1820_13830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phq04147]
    D1820_13830
Enzymes [BR:phq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     D1820_13830
    4.1.1.105  L-tryptophan decarboxylase
     D1820_13830
Exosome [BR:phq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D1820_13830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DUSP MoCF_biosynth Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AXT35960
Position
complement(2892970..2894379)
Genome map
AA seq 469 aa AA seqDB search
MNWTDFSHWGRKIADWTQHYHQTVGDRPVRARTEPGDVLNALPATPPETGEGMEAIFADF
ETVVMPGITHWQHPRFFAYFTSNAAAPSVLAEFLTSAIAPQCMLWQTSPAATEMETRMMD
WLRQALDLPEEFQGVIQDSASSATLAAVLTMREKALNWQGNEQGLFSQKTLRIYCSSEVH
TSVDRAIWVAGIGQQNLVRVPIKGDWRGMDPDALAAAIEADIAAGHQPAGVILCVGGTGV
GATDPVDQILDVAENYGLYTHVDAAWAGSAMICPEYRHYWPGIERADSIVFNPHKWLGVQ
FDCSAHFLKDPDDLVRTLAISPEYLKTHGKDGIINYSEWSVPLGRRFRALKIWFLIRTYG
LEGLRQRLRNHVTWSQQLHDRLQLEPDFEIVTPPMWSLWSFRYQPDGAKDLDDLNLRLVN
AINDDGRIYLTQTRVDGALVIRFQAGQFETTEADVMMAHDVIIEIARTL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaactggactgacttttcccattgggggcgcaagattgccgactggacccaacactac
catcagacggttggcgacaggccggtgcgcgccagaaccgaacccggtgacgttctgaat
gcgcttcccgccacgccgcccgaaaccggcgaaggcatggaggccatctttgccgatttt
gaaaccgttgtgatgcccggaatcacccattggcagcatccacggttctttgcctacttc
acctccaatgccgctgccccatcggtgcttgcggaattcctcacctctgccatcgcaccg
caatgcatgctctggcagacctcccctgcggcgaccgaaatggaaacccgcatgatggac
tggctgcgccaagcgcttgacctgccagaagagtttcagggtgtcattcaggacagtgcc
tcttccgccaccctggcagccgtcctcacgatgcgggaaaaggcgctaaactggcagggc
aatgagcaggggctattttcccagaagactctgcgcatctactgctcttcggaggtgcac
acctccgtcgatcgcgccatctgggttgccggtatcggccagcagaatcttgtccgtgtt
ccgatcaagggggactggcgcggcatggacccggacgcactggccgcagcaattgaggcc
gacatcgcggccggccaccagcccgccggcgtcatcctctgtgttgggggcacgggagtt
ggcgccaccgacccggtcgatcagatactcgatgtggctgaaaattatggtctctatacc
catgtggatgccgcctgggccggctccgccatgatctgccccgaataccgccattactgg
cccggaattgagcgcgcagacagcatcgttttcaacccccacaaatggctgggggtgcaa
tttgattgctccgcccatttcctgaaagatcccgacgatctggtccgaacgctggccata
agccccgaatatctcaaaacccatggcaaagatggtatcatcaactactctgaatggtca
gtgcccctgggccgccgtttccgtgcgctcaaaatctggtttctgatccggacctacggt
ctggaagggctgcgccaacggttgcgcaaccatgtgacatggtcacagcaattgcatgac
cggctccagttagagcctgatttcgagatcgtgacgccgccaatgtggtctctctggtcc
tttcggtatcaacccgatggagccaaggatctggacgatctgaatctgcggttggtgaat
gcgatcaacgacgatggccgcatttacctgacccagacccgcgtcgatggcgcactggtg
atccgttttcaggcagggcaatttgaaacaaccgaagccgatgtcatgatggcacatgat
gtcatcatcgaaatcgcccgaacgctatag

DBGET integrated database retrieval system