KEGG   Phaeobacter sp. LSS9: D1820_15165Help
Entry
D1820_15165       CDS       T05617                                 

Definition
(GenBank) haloacid dehalogenase type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
phq  Phaeobacter sp. LSS9
Pathway
phq00361  Chlorocyclohexane and chlorobenzene degradation
phq00625  Chloroalkane and chloroalkene degradation
phq01100  Metabolic pathways
phq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:phq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    D1820_15165
   00361 Chlorocyclohexane and chlorobenzene degradation
    D1820_15165
Enzymes [BR:phq01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     D1820_15165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like Hydrolase_6 HAD
Motif
Other DBs
NCBI-ProteinID: AXT36210
Position
complement(3173721..3174407)
Genome map
AA seq 228 aa AA seqDB search
MAITTCIFDAYGTLFDVTAAARQAAQEPEFPHLVDHWAELANHWRLKQLQYTWLRAITDA
HTDFWQVTQDGLDWAMDATGLSGDPQLRKRLLDLYWQLQAYEEVPQMLRALKTAGLQTAI
LSNGSPKMLEGAVNSAGVSGLLDDVLSVEAVGVFKPDAQVYDLVEERFNCQRDEVLFVSS
NGWDAAGAAGYGFTTAWVNRSGEPMDRLPWTPHHILSDLSSIPTLLGT
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcacaacctgtatcttcgatgcctatggcacattgttcgacgtgacggcggcc
gcgcggcaagccgcccaggaaccagagttcccgcatctggtcgaccattgggccgagctg
gccaaccactggcgactgaagcagctgcaatacacctggctgcgcgccatcaccgacgcc
cacaccgatttctggcaggtcacccaagatggattggactgggcgatggacgccaccggc
ctcagtggggatccgcaactccgcaaacggttgctcgatctctattggcagcttcaggcc
tatgaggaggtgccgcagatgctgcgcgcgctcaagacggctgggctgcagacagcgatc
ctgtccaatggatcacccaagatgctggaaggtgcagtcaactcggccggggtgagcggg
ctgctggacgatgtcttgtctgtcgaggccgtcggggtcttcaaacccgatgcacaggtc
tacgacctcgtcgaggaacggttcaactgtcagcgcgacgaggtattgtttgtctcctcc
aacggctgggacgccgccggcgcggcggggtatggattcaccaccgcctgggtcaatcgg
agcggcgagcccatggatcgcctgccttggacgccacatcatatcctgagcgacctgagc
agtattccgacattgcttgggacataa

DBGET integrated database retrieval system