KEGG   Phaeobacter sp. LSS9: D1820_17380Help
Entry
D1820_17380       CDS       T05617                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
phq  Phaeobacter sp. LSS9
Pathway
phq00010  Glycolysis / Gluconeogenesis
phq00053  Ascorbate and aldarate metabolism
phq00071  Fatty acid degradation
phq00280  Valine, leucine and isoleucine degradation
phq00310  Lysine degradation
phq00330  Arginine and proline metabolism
phq00340  Histidine metabolism
phq00380  Tryptophan metabolism
phq00410  beta-Alanine metabolism
phq00561  Glycerolipid metabolism
phq00620  Pyruvate metabolism
phq00625  Chloroalkane and chloroalkene degradation
phq00903  Limonene and pinene degradation
phq01100  Metabolic pathways
phq01110  Biosynthesis of secondary metabolites
phq01120  Microbial metabolism in diverse environments
phq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:phq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D1820_17380
   00053 Ascorbate and aldarate metabolism
    D1820_17380
   00620 Pyruvate metabolism
    D1820_17380
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D1820_17380
   00561 Glycerolipid metabolism
    D1820_17380
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D1820_17380
   00310 Lysine degradation
    D1820_17380
   00330 Arginine and proline metabolism
    D1820_17380
   00340 Histidine metabolism
    D1820_17380
   00380 Tryptophan metabolism
    D1820_17380
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D1820_17380
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    D1820_17380
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    D1820_17380
Enzymes [BR:phq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     D1820_17380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AXT36868
Position
unnamed1:complement(7123..8607)
Genome map
AA seq 494 aa AA seqDB search
MSADQLSAAYFETGTLPDLPRDHFIDGRAVAPGAGGRMESFDPGRGMAFADFAAGDAADV
DHAVTSAVAGFEVWSATPPARRCAILNEAARLMRQEAERFAVVECVDSGKTLAEARGDIA
GSARLLEYYAGAADKLDGRSVNLGNDNAAFTLREPVGVTAHIVPWNYPTSTLVRGISPAL
AAGCSAVVKPAETTPFTALMIADLLIRAGLPAGVVNVVTGTGLAAGAPLVRDPRVRHVTF
TGSVATGVGVMQSVAPNVTGLTLELGGKSPLVAFGDADVDAVVEGALWAIFSNAGQICSA
GSRLVIHRNLHAEVRDKLVARAQMLRVGHGLRGPDIGAVNSARHLAQIADHVSRARTRGV
EIVTGGEVLTDIERGAGWFYAPTILDNLAATDDAVLKEIFGPVLAIQVFDDEAEALALAN
GTEFALAAGIYTKDIATALRMARRVDAGQVTVNDYWAGGIELPFGGNRKSGFGREKGLEG
LDAYTRSKAITLAV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgatcagttgagtgcggcctatttcgagaccgggacgctgcccgatctgccg
cgtgatcatttcattgatgggcgggctgttgcacccggggccggcgggcggatggagagt
ttcgaccccggacggggcatggcctttgctgattttgctgcgggcgatgcggcggatgtc
gatcacgcggtgaccagcgccgtagctgggtttgaggtctggagtgccacaccgcctgcg
cggcgatgcgccatcctgaacgaagccgcccggctgatgcggcaggaggcggagcgtttc
gccgttgttgaatgcgtcgatagcggcaagaccctggcagaggcacgtggtgatatcgcg
gggtctgcccgactgctggagtattacgccggcgctgcggacaaattggatgggcgcagc
gtgaacctcggcaatgacaatgctgcattcaccctgcgcgaaccggtgggtgtgaccgct
catatcgtgccgtggaactatccgacctcaaccttggttcgtggtatttcgccggcgctg
gcggcggggtgttctgcggttgttaaaccggcggagacaacgccgttcacggccctgatg
atcgccgatctgctgatccgcgcggggctgcctgcgggcgtcgtcaatgtggtgacgggc
accggacttgctgcaggcgcgccgctggttcgggatccgcgtgtgcggcatgtcaccttc
accggatcggtggccaccggcgttggtgtgatgcagagcgtcgcccccaatgtgaccggg
ctgacattggagctgggaggtaagtcccctcttgttgcctttggtgacgcggatgtggat
gccgtggttgagggtgcgctctgggctattttctcaaacgcggggcagatctgttcggct
gggtcgcggttggtgatccaccgcaatcttcatgccgaggtgcgtgacaaactggtggcg
cgggcgcagatgttgcgggtgggccatgggttgcgcgggccggatatcggtgcggtaaac
tccgcccggcatttggcgcagatagctgatcacgtcagccgggcccggactcgcggcgtc
gagattgtcaccggtggtgaggttctgaccgatattgagaggggcgcgggctggttctat
gcgccgaccatcctggataacctcgcggccactgatgatgccgtcctgaaggagattttt
ggccctgtgttggcaatccaggtttttgacgacgaggcagaggcgctggcattggccaat
ggcaccgaatttgcgctggcggcgggtatctataccaaggatatcgcaaccgcgctgcga
atggcgcggcgggttgatgccgggcaggtgaccgtcaatgactattgggcgggcgggatt
gagctgccgtttggtggcaatcgtaaatcggggttcgggcgagagaaggggctggaaggt
ctggatgcctataccagaagcaaggcgattacgttggccgtctga

DBGET integrated database retrieval system