KEGG   Phreatobacter sp. S-12: C6569_04750Help
Entry
C6569_04750       CDS       T05356                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
phr  Phreatobacter sp. S-12
Pathway
phr00970  Aminoacyl-tRNA biosynthesis
phr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C6569_04750
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:phr03029]
    C6569_04750
Enzymes [BR:phr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     C6569_04750
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     C6569_04750
Mitochondrial biogenesis [BR:phr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    C6569_04750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AVO44426
UniProt: A0A2S0N8I5
Position
complement(985561..986862)
Genome map
AA seq 433 aa AA seqDB search
MSTAVRDALEASLARIDDPSSDGRVTFTKVYAERARAEADAADARAKAGVKLSPLDGWVI
SIKDLFDVAGEVTTAGSVILKSQPPAAADAPTVARLRQAGVVIVGKTNMSEFAFSGIGIN
PHFGTPGNAADKSRVPGGSSSGAGVSAAEGTVRMGLGSDTGGSIRIPAALNGCVGFKPTY
GRIPLEGAFPLSYALDTIGPLAKTVADCAATDAVLAGEQPWTPTPAPLAGLRLAIPRGRL
FGQIEPEVEQAFEAAASRLGKAGARITDISIEDLLQELADAMARAPFVAMEAAAIHAEWM
EERARDFDPRVLARIRIGAKASAPDYIRLVNKRAELVARMRDRLADIDALILPTTPIRAP
KISDLIASDDQFWTANGLMLRNTTVGNIFTFTGISIPCPKVKGLPVGFMMTALAGQDRRL
LRMAAAVEQAFTA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgccgtccgcgatgcgctcgaagcctcgctcgcccgcatcgacgacccctct
tccgatggacgcgtgaccttcaccaaggtctatgcggagcgggcgcgggcggaggcggac
gccgccgatgcgcgcgccaaggcgggcgtgaagctgtcgccgctcgacggctgggtcatt
tcgatcaaggacctgttcgacgtcgccggcgaggtgaccaccgccggctcggtcatcctg
aagtcgcagccgccggcggccgccgacgcgccgaccgtcgcgcgcctgcgccaggcgggc
gtcgtcatcgtcggcaagaccaacatgagcgaattcgccttttccggcatcggcatcaac
ccgcatttcggaacgccgggcaacgccgccgacaagagccgcgtgcccggcggctcctct
tccggcgccggcgtctcggcggcggaggggacggtgcgcatgggcctcggctcggatacc
ggcggctccatccgcatccccgcggcgctgaacggctgcgtcggcttcaagccaacctat
ggccgcattcccctggagggcgccttccccctctcctacgcgctcgacaccatcggcccg
ctggcgaagacggtggccgactgcgccgccaccgacgcggtgctcgccggcgagcagccc
tggacgccgacgccggcgccgctggccggcctcaggctcgccatcccgcgcgggcggctc
ttcggccagatcgagccggaggtcgagcaggccttcgaggccgccgcctcccgcctgggc
aaggccggcgcccgcatcaccgacatctcgatcgaggacctgctgcaggagctcgccgac
gccatggcgcgggcgcccttcgtcgccatggaggcagccgccatccacgcggagtggatg
gaggagcgggcccgcgacttcgatccgcgggtgctggcgcgcatccgcatcggcgccaag
gcgtccgcccccgactacatccgcctcgtcaacaagcgcgccgagctggtggcgcgcatg
cgcgaccgcctcgccgacatcgacgccttgatcctgccgacgacgccgatccgcgccccg
aagatctcggacctcatcgcctcggacgatcagttctggacggccaacgggctcatgctc
cgcaacaccaccgtcggcaacatcttcaccttcaccggcatctcgatcccctgcccgaag
gtgaagggcctgccggtgggcttcatgatgacggcgctcgccggtcaggaccgccgcctg
ctccgcatggccgcagcggtggagcaggccttcaccgcctga

DBGET integrated database retrieval system