KEGG   Paraburkholderia hospita: C2L64_06110Help
Entry
C2L64_06110       CDS       T05305                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
phs  Paraburkholderia hospita
Pathway
phs00230  Purine metabolism
phs00240  Pyrimidine metabolism
phs01100  Metabolic pathways
phs01110  Biosynthesis of secondary metabolites
phs01130  Biosynthesis of antibiotics
Module
phs_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
phs_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
phs_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:phs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C2L64_06110
   00240 Pyrimidine metabolism
    C2L64_06110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phs04131]
    C2L64_06110
Enzymes [BR:phs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     C2L64_06110
Membrane trafficking [BR:phs04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    C2L64_06110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AUT67957
UniProt: A0A244DHU7
Position
1:1367958..1368383
Genome map
AA seq 141 aa AA seqDB search
MAIERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVASRMVHLSRADAEKFYAVHAERPFF
KDLVEFMISGPVQVQVLEGEGAILKNRDLMGATDPKKADKGTIRADFADSIDANAVHGSD
AVETARGEIAFFFPEVNVYSR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgaacgcaccctgtcgattatcaagccggacgcagtggccaagaacgtgatc
ggccagatctacagccgcttcgaaaacgctggcctgaagatcgtggcatcgcgcatggtt
catctgtcgcgcgctgacgcagagaagttctacgctgtgcacgcagaacgcccgttcttc
aaggatctggttgagttcatgatctccggcccggtgcaggttcaagttctggagggcgaa
ggcgccatcctgaagaaccgcgatctgatgggtgcaaccgacccgaaaaaggccgacaag
ggcacgatccgcgctgacttcgctgacagcatcgacgcgaacgcagtccatggctcggac
gcagtggaaacggcacgcggcgaaatcgcgttcttcttcccggaagtcaacgtctactcg
cgctaa

DBGET integrated database retrieval system