KEGG   Paraburkholderia hospita: C2L64_08990Help
Entry
C2L64_08990       CDS       T05305                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
phs  Paraburkholderia hospita
Pathway
phs00071  Fatty acid degradation
phs00072  Synthesis and degradation of ketone bodies
phs00280  Valine, leucine and isoleucine degradation
phs00310  Lysine degradation
phs00362  Benzoate degradation
phs00380  Tryptophan metabolism
phs00620  Pyruvate metabolism
phs00630  Glyoxylate and dicarboxylate metabolism
phs00640  Propanoate metabolism
phs00650  Butanoate metabolism
phs00900  Terpenoid backbone biosynthesis
phs01100  Metabolic pathways
phs01110  Biosynthesis of secondary metabolites
phs01120  Microbial metabolism in diverse environments
phs01200  Carbon metabolism
phs01212  Fatty acid metabolism
phs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:phs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C2L64_08990
   00630 Glyoxylate and dicarboxylate metabolism
    C2L64_08990
   00640 Propanoate metabolism
    C2L64_08990
   00650 Butanoate metabolism
    C2L64_08990
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C2L64_08990
   00072 Synthesis and degradation of ketone bodies
    C2L64_08990
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C2L64_08990
   00310 Lysine degradation
    C2L64_08990
   00380 Tryptophan metabolism
    C2L64_08990
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C2L64_08990
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C2L64_08990
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C2L64_08990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phs04147]
    C2L64_08990
Enzymes [BR:phs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C2L64_08990
Exosome [BR:phs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C2L64_08990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AUT68443
UniProt: A0A1H6LAU4
Position
1:complement(2010732..2011916)
Genome map
AA seq 394 aa AA seqDB search
MQREVVVVSGVRTAIGDFGGSLKDFAPTDLGARVVREALSRASVSGDEVGHVVFGNVIHT
EPKDMYLARVAALNGGVAQHTPALTVNRLCGSGLQAIVSAAQAVLLGDADIAIGGGAESM
SRAPYIMPSARFGQRMGNASIVDMMLGALHDPFQSIHMGVTAENVAKKYDISRDTQDALA
LESHRRAAKAIESGYFKEQILPITIASKKGDTVFDTDEHVRMNATSDDFAKLKAVFAKEN
GTVTAGNASGINDAAAAVVLMERSVAEKRGAKPLGRLVAYAHAGVDPNYMGIGPVPATQK
ALERAGLKVGDLDVIEANEAFAAQACAVSKELGFDPAKVNPNGSGISLGHPIGATGALIT
VKALYELQRIGGRYALVTMCIGGGQGIAAIFERI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgtgaagtggtggtagtgagcggcgtgcgcacggcaatcggcgacttcggcggc
agcctcaaagacttcgcaccgacggatctcggcgcgcgcgtggtgcgcgaggcattgtcg
cgcgcgagcgtctccggcgacgaagtcggccatgtcgtgttcggcaacgtcatccatacc
gagccgaaagacatgtacctcgcgcgcgtcgcggcgctcaacggcggcgtcgcgcagcat
acgcccgcactgaccgtgaaccggttgtgcggctcgggcctgcaggcaatcgtatcggcg
gcgcaagccgtgttgctcggcgacgcggatattgcgatcggcggcggcgcggaaagcatg
agccgcgcgccgtacatcatgccgtcggcgcgcttcggccagcgcatgggcaatgcgagc
atcgtcgacatgatgctcggcgcgctgcacgatccgtttcagtcgatccacatgggcgta
acggccgagaacgttgcgaagaaatacgacatctcccgcgacacacaggacgcgctcgcg
ctcgaatcgcaccgccgcgcggcgaaggcgatcgaaagcggctacttcaaggaacagatt
ctccccatcacgatcgcgtcgaagaaaggcgacaccgtcttcgacacggacgagcacgtc
cgcatgaacgcgacgtccgacgacttcgcgaaactgaaagccgtgttcgcgaaggaaaac
ggcacggtcacggcgggcaatgcgtcgggcatcaacgacgcggccgcggctgtcgtgctg
atggagcgcagcgtcgccgagaagcgtggcgcgaagccgcttggccggctcgttgcgtat
gcgcatgcgggcgtcgatccgaactacatgggcatcggccccgtgcccgcgacgcagaag
gcgctggagcgcgccggcctgaaagtcggcgatctcgacgtaatcgaagcgaatgaggcg
tttgccgcacaggcgtgcgccgtcagcaaggaactgggcttcgatcccgcgaaggtgaac
ccgaacggctcgggcatttcgctcggtcatccaatcggcgcgacgggcgcgctcatcacc
gtcaaggcgctgtacgagttgcagcgtatcggcggccgttatgcgctcgtgacgatgtgc
atcggcggcgggcagggcattgcggcgatcttcgagcggatctga

DBGET integrated database retrieval system