KEGG   Paraburkholderia hospita: C2L64_11505Help
Entry
C2L64_11505       CDS       T05305                                 

Definition
(GenBank) phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
phs  Paraburkholderia hospita
Pathway
phs00564  Glycerophospholipid metabolism
phs01100  Metabolic pathways
phs01110  Biosynthesis of secondary metabolites
Module
phs_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:phs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C2L64_11505
Enzymes [BR:phs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     C2L64_11505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase ATP-synt_J
Motif
Other DBs
NCBI-ProteinID: AUT68876
UniProt: A0A244DVV8
Position
1:complement(2541459..2542097)
Genome map
AA seq 212 aa AA seqDB search
MNYPHPIIAREGWPFIAIAAVVALLIHFIAGFGIAWIFWLLLIFVVQFFRDPARPIPTQA
NAVLCPADGRIVAVETAHDPYANREALKISVFMNVFNVHSQRSPVDGAISKVEYFPGAYL
NAAVDKASTENERNAVVIETASGATVTSVQIAGLIARRILCYVRAGEPLTRGQRYGFIRF
GSRVDVYLPVGSRPRVSIGEKVSASSTVLAEL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaattaccctcatccgatcatcgcgcgcgaaggctggccgttcattgccatcgcggcc
gtcgttgcgttgttgatccacttcatcgcagggttcggcattgcctggattttctggctg
ttgctcatcttcgtcgtgcagttcttccgcgacccggcgcgtcccatcccgacgcaggcc
aacgcggtgctgtgcccggccgacggccgcatcgtcgctgtcgaaaccgcgcacgatccg
tacgcgaaccgtgaagcgctgaagatcagcgtgttcatgaacgtgttcaacgtgcactcg
cagcgctcgcccgtcgatggcgcaatctcgaaggtcgaatattttccgggcgcgtacctg
aacgccgctgtcgacaaagcgtcgacggagaatgagcgcaacgcggtcgtgatcgaaacg
gcgagcggcgcgacggtgacgtcggtgcagatcgcgggcctgatcgcgcggcgcattctc
tgctacgtcagggcaggcgagccgcttacgcgcggccagcgctacggcttcatccgtttc
ggttcgcgcgtcgacgtgtatctgcccgtgggcagccgcccgcgtgtgtcgatcggcgag
aaggtttcggcttcgtccacggttctggctgaactataa

DBGET integrated database retrieval system