KEGG   Paraburkholderia hospita: C2L64_12140Help
Entry
C2L64_12140       CDS       T05305                                 

Gene name
ompR
Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
phs  Paraburkholderia hospita
Pathway
phs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:phs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C2L64_12140 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:phs02022]
    C2L64_12140 (ompR)
Two-component system [BR:phs02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   C2L64_12140 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C B12-binding HAD
Motif
Other DBs
NCBI-ProteinID: AUT68986
UniProt: A0A244DGD8
Position
1:complement(2682768..2683493)
Genome map
AA seq 241 aa AA seqDB search
MATQILVVDDDVELRDLLRDYLARQGIEVSVLHDASSLERRIERERPDLIVLDLMMPGVD
GLTALRKLRASGDDIPVIMLTARADDVDRIVGLELGADDYLGKPFNPRELLARVQAVLRR
RKTLPSAAAPEQREPFSFGRFTLDFQSRTLHQEGKPLTLSGSEFALLKIFVNHPMRTLTR
ERLLELLHGPEYDGTDRGIDVQVWRLRRILETDPSVPRFIQTVRGRGYVFVPDGEQHAAS
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctactcaaattctggtcgtcgatgacgacgtcgaactgcgcgatctgctgcgcgac
tatctggcccggcaaggcatcgaagtgtcggtgctgcacgacgccagttcactggagcgc
cgcatcgagcgcgaacggcccgacctgatcgtgctcgacctgatgatgccgggcgtcgac
ggtctcacggcgctccgcaagctgcgcgcgtcgggcgacgatatccccgtgatcatgctg
acggcgcgcgcggacgacgtggatcgcatcgtcggcctggaactcggcgccgacgattac
ctcggcaagccgttcaacccgcgcgaattgctggcgcgcgtgcaggcggtgttgcgccgc
cgcaagacgctgccgtcggcggctgcgcccgaacagcgcgagccgttctcgttcggccgc
ttcacgctcgacttccagtcccgcacgctgcatcaggaaggcaagccgctcacgttgtcg
ggtagcgaattcgcgctgctgaagatcttcgtcaatcacccgatgcgcacgctcacgcgc
gagcgcctgctcgaactgctgcacggtcccgaatacgacggcaccgaccgcggcatcgac
gtgcaggtgtggcgcctgcgccgcattctcgaaaccgatccgtccgtgccgcgcttcatt
cagaccgtacgcggacgcggatacgtgttcgtccccgatggcgagcaacatgcggcgtcc
aattga

DBGET integrated database retrieval system