KEGG   Paraburkholderia hospita: C2L64_16060Help
Entry
C2L64_16060       CDS       T05305                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
phs  Paraburkholderia hospita
Brite
KEGG Orthology (KO) [BR:phs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C2L64_16060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: AUT69635
UniProt: A0A244DQQ0
Position
1:complement(3551162..3551536)
Genome map
AA seq 124 aa AA seqDB search
MSQYEFSVSSQVRYIAEESDPEHRKYAFAYTLTIRNTGQVAAQLIARHWVITDSENRVQE
VKGLGVVGHQPLLKPGEQFEYTSYAVIATPVGTMRGEYFCVAEDGERWDAPVPEFVLRMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtacgaattcagcgtgtcctcccaggtccggtacatcgccgaggagtcggac
ccggagcatcggaagtacgctttcgcctacacgctcaccatccgcaatacaggccaggtc
gccgcgcaactgatcgcgcgtcactgggtcattacggatagcgaaaaccgtgttcaggaa
gtgaaaggcctcggtgtggtcgggcatcagccgttgctgaagccgggcgagcagttcgag
tacaccagctacgcggtgatcgcgacacccgtggggacgatgcgcggcgagtatttttgc
gtggcggaggacggtgagcgctgggacgcacccgtaccggaattcgttctgcggatgccg
cgcacgctgcattga

DBGET integrated database retrieval system