KEGG   Phyllobacterium zundukense: BLM14_04700Help
Entry
BLM14_04700       CDS       T05167                                 

Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
pht  Phyllobacterium zundukense
Pathway
pht00670  One carbon pool by folate
pht01100  Metabolic pathways
pht01120  Microbial metabolism in diverse environments
pht01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pht00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BLM14_04700
Enzymes [BR:pht01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BLM14_04700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ATU91010
UniProt: A0A2N9W2Q9
Position
979672..980598
Genome map
AA seq 308 aa AA seqDB search
MSFFRQSRRPDLGTNIRVSFEFFPPKTEVMEERLWETVTRLAPLHPEFVSVTYGAGGSTR
ERTARTIKRILTETDVNAAAHLTCVDATKEEVDTVVREFAAMGVKRFVALRGDPAGGVGA
HYKPTAGGYENGADLVAGLKAFADFDISVSAYPEKHPESPDFATDIDMLKRKVDNGATRA
ITQFFFENDLYERYVEKVRRAGIYIPILPGILPIHNFTQVTNFCSRAGTHIPGWLTERFD
GLENDPQTHQLVASAVAAEQVLDLVERGVQDFHFYTMNRADLAFAICHLIGIRPGSAALE
ADLAGAAA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagttttttccgccaatcacgccgtcccgatcttggtaccaatatccgggtttcgttc
gaattcttcccgcccaagaccgaggtcatggaagagcggctttgggagaccgtgacgcgc
ctcgcgccgctccatcctgaattcgtgtcggtgacttatggtgcgggcggatcgactcgt
gaacgcactgcccgtaccatcaagcgcatcctcacggaaaccgatgtcaatgcggcggca
cacctgacctgcgtcgatgcgacgaaggaagaggtggataccgtcgtgcgcgagtttgcc
gccatgggcgtcaagcgttttgtcgcgctgcgcggcgacccggcggggggtgtcggtgct
cactacaagccaactgccggtggctatgagaacggcgccgatctggtcgctggtctgaag
gctttcgccgatttcgacatttccgtctccgcctatccggaaaagcatccggagagcccg
gattttgccaccgacatcgatatgctgaagcgcaaggtcgacaatggtgcgacgcgggcg
atcacgcagttcttctttgaaaatgacctctatgagcgttatgtcgaaaaagtgcgccgc
gctggcatctatattcccattctgccggggatactgccgatccacaatttcacgcaagtg
accaatttctgctcgagggcgggaacacatattcccggctggcttacagaacgatttgac
ggtctcgaaaacgatccgcagacgcatcaactggttgcgtcagccgtcgctgccgaacag
gtgctcgacctcgttgagcggggcgtacaggatttccatttctacacgatgaaccgggcc
gatctcgcctttgccatctgccacctgattggcatccgcccgggcagcgccgcgctagag
gcggatcttgccggggctgccgcctga

DBGET integrated database retrieval system