KEGG   Phyllobacterium zundukense: BLM14_09525Help
Entry
BLM14_09525       CDS       T05167                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pht  Phyllobacterium zundukense
Pathway
pht03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pht00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BLM14_09525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pht03011]
    BLM14_09525
Ribosome [BR:pht03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BLM14_09525
  Bacteria
    BLM14_09525
  Archaea
    BLM14_09525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ph1570
Motif
Other DBs
NCBI-ProteinID: ATU91835
UniProt: A0A2N9W4M9
Position
complement(1926250..1926639)
Genome map
AA seq 129 aa AA seqDB search
MGKAKAPRQLKDNEAKAVARTLRISPQKLNLVAALIRGKKVNAALADLEFSRKRIAGTVK
KTLESAIANAENNHDLDVDALVVAEAYVGKSVVMKRFHVRGRGRASRIEKPFSHLTIVVR
EAEEKGEAA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggctaaggctccgcgccagcttaaggacaacgaggcgaaagccgttgcccgt
acgctccgcatcagccctcagaagcttaatctggtggctgctctgatccgtggcaagaag
gttaatgccgctcttgccgatctggaattttcgcgcaagcggattgcaggcacggtgaaa
aagactctcgaatcagctatcgccaacgcagaaaacaaccatgacctggatgttgatgct
ctggttgttgctgaagcctacgttggcaagtcagtcgtgatgaagcgtttccatgttcgt
ggtcgcggtcgtgcaagccggatcgagaagccattctcgcatctgacgatcgtcgttcgc
gaagctgaggaaaaaggggaggccgcataa

DBGET integrated database retrieval system