KEGG   Phyllobacterium zundukense: BLM14_15905Help
Entry
BLM14_15905       CDS       T05167                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
pht  Phyllobacterium zundukense
Pathway
pht00360  Phenylalanine metabolism
pht00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pht00790  Folate biosynthesis
pht01100  Metabolic pathways
pht01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pht00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BLM14_15905
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLM14_15905
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLM14_15905
Enzymes [BR:pht01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BLM14_15905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ATU92933
UniProt: A0A2N9VSQ5
Position
complement(3213786..3214619)
Genome map
AA seq 277 aa AA seqDB search
MTISVEAYARECAEQGLRGNYAVCHADFTVEQQYDYSDEDQEVWRTLCDRQTKLTSKLAH
HSYLDGVDALGLLDRIPDFHEVSERLRKLTGWEIVAVPGLIPNEPFFDHLANRRFPVTNW
LRSKKELDYIVEPDMFHDFFGHVPILSQPVFADFMQLYGEKGGAASRMGGEQLAARLYWY
TAEFGLMQEEGELLKAFGAGLMSSFTELQFAVTSPDAHHVPFDLETVMHTAYEIDKFQRA
YFVLPSFAALRDAFEKADMPKLIARWKDAEPMDPATV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcagcgttgaagcctatgcccgcgaatgcgccgagcagggattgcgtggcaac
tacgccgtttgccatgcggatttcaccgtcgagcagcaatacgactattcggatgaggac
caggaagtatggcgcaccctctgcgatcgccagacgaaattgacgtcgaagcttgcccat
cacagttatctcgacggcgtggacgcgctcggtcttctggatcgcattccggatttccat
gaggtcagcgagcggctgcgcaaattgaccggctgggagattgtcgccgtgccgggcctg
atcccgaacgagccgtttttcgatcatcttgccaaccggcgctttccggtgaccaactgg
ctgcgcagcaagaaagaactcgactacatcgtcgagcccgacatgttccacgacttcttt
ggccatgttcccatcctgagccagccggtctttgcggatttcatgcaactttacggtgag
aagggcggtgccgcttcacgcatgggcggcgagcagttggcggcccggctttactggtac
acagcggaattcgggttgatgcaggaggaaggcgagctgctcaaggcgtttggcgctggc
ctcatgtcatcgttcaccgaattgcagtttgcggtaaccagtcccgacgcgcaccatgtg
ccgttcgatctggaaacggtaatgcacaccgcctatgaaatcgacaagttccagcgggcc
tattttgttttgccatcatttgcggcgctcagagatgccttcgaaaaggccgatatgccg
aagctgattgcacgctggaaagatgcggagccgatggatcccgcgaccgtatga

DBGET integrated database retrieval system