KEGG   Phyllobacterium zundukense: BLM14_26385Help
Entry
BLM14_26385       CDS       T05167                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pht  Phyllobacterium zundukense
Pathway
pht00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BLM14_26385
Enzymes [BR:pht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BLM14_26385
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BLM14_26385
    1.1.1.-  
     BLM14_26385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ATU95253
UniProt: A0A2N9VYV5
Position
unnamed2:267384..268460
Genome map
AA seq 358 aa AA seqDB search
MKALRFHAAKDLRLEEIAKPTSNPPSGQVLIRNTFVGICGTDLHEYVSGPIFIPVEPHPF
TGTSGPQVLGHEFGGVVEAVGEGVTSVKPGDRVSVQPLIMPRSGDYFADRGLFHLSTDLA
LAGLSWQSGGMAEYALLNEYNVQNIPDEMTDEEAALVEPSAVAVYACDRGGVAAGSSVLV
TGAGPIGVLTLLAARAAGAAQLFLSDINDTRLHLARTILPDVVTINPVRETVGDVVRSKT
EGGVGCDVAIECVGNEHALKACTDAVRKQGVVVQTGLHPHENPLDWFQVTFKDIDLRGSW
AYPTHYWPRVIRLIGSGLLPANKVITKRITLNEAVAEGFETLLDPAGKHLKILIDMTA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattgcgtttccatgcggcgaaggatttgcgtctcgaagagatcgctaaacca
acgtcgaatccaccaagtggacaagttctcatccgcaatacgtttgtcggtatctgcggc
actgatctgcatgaatatgtgtcgggcccaattttcattccggttgaaccgcatcccttc
accgggaccagcggcccacaggtgctcggccacgaatttggcggagttgttgaggcggtg
ggtgagggcgtcacatcagtcaagccgggagaccgcgtgtccgtgcagccgctgatcatg
ccccgctctggcgattattttgccgatcggggcctgttccacctcagcacagatctcgca
cttgcaggtttgagctggcagtcaggcggcatggcggaatacgctctgctcaacgaatac
aatgttcagaatatccccgatgaaatgaccgatgaggaagcggctctcgttgagccgtca
gcagtcgcggtctatgcctgtgaccgcggcggtgtggccgctggaagcagcgtattggtt
actggagctggacccatcggtgtgctgacgctgctggcggcccgcgcggcaggcgcagca
cagcttttcttgtcggacatcaacgatacgcggcttcacctcgcaaggaccattttgccc
gatgtcgttacaatcaaccccgtgcgcgaaacggttggcgacgtcgtacgctccaagaca
gaaggtggcgtcggctgtgatgtagcaatcgagtgcgttggcaatgaacatgcgttaaaa
gcctgcaccgatgccgtgcgcaaacaaggggtcgtcgtacagacgggactgcatccccac
gagaacccgctcgattggtttcaagtcacgttcaaggacatcgaccttcgcggatcctgg
gcttatcccacccattattggccccgtgtgatccggttgattggttctgggcttttgccc
gccaacaaggtcatcaccaaacgcatcacccttaatgaagctgtggcggaaggctttgaa
accctgcttgatcccgcgggcaagcatctgaagattctgatcgacatgactgcatag

DBGET integrated database retrieval system