KEGG   Phyllobacterium zundukense: BLM14_30105Help
Entry
BLM14_30105       CDS       T05167                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
pht  Phyllobacterium zundukense
Pathway
pht02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pht00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BLM14_30105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pht02000]
    BLM14_30105
Enzymes [BR:pht01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     BLM14_30105
Transporters [BR:pht02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    BLM14_30105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N ABC_ATPase AAA_30 RsgA_GTPase AAA_29 Zeta_toxin ACT_7 STAS MMR_HSR1 AAA_23 AAA_15 AAA_25
Motif
Other DBs
NCBI-ProteinID: ATU95971
Position
unnamed5:complement(181251..182789)
Genome map
AA seq 512 aa AA seqDB search
MNTDVLLSMTGIDKRFAGIPALSAASFAVGRGEVHALIGQNGAGKSTLIKVLTGYHRRDA
GEVTFDGKPFEVFSPQQAQASGISTIYQEINLVPYCSITENICLGREARRYGLLDWNRMH
REAETLLQRFNVRVDVHRPLMEFNTATQQMVAIARAIGFSAKLVIMDEPTSSLDEREVSV
LFDVIRQLKQEGVSVVFVSHKLDELYKVCDRVTIMRDGRTVKTASMNEIDKIGLVSSMLG
RAIKRAEGHATAFSDRDQKKIGKVLFSAENLAINQTVQDVSFNVRSGEIAGFAGLLGAGR
TETARLVFGIDRPRAGTMYYDGRKFDPRNPSDAIVAGMGFCTEDRKSEGIVPEMSVAENM
MLALMPKLSNSGIIDEKAQRDIVERFIRQLGIKCSGPDQKVRELSGGNQQKVLLGRWLAM
NPRLLILDEPTRGIDVGAKGEIQSLIKSLADQGLSVLMISSELEEVIEGADRVFVLREGV
SVAEFDRDRATEDTLMSAMAHGSAPHSAGTVS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgacgttctcctgtcgatgacgggcatcgacaaacgttttgccggaattccc
gccctatccgccgcttcctttgcggtcggacgcggcgaagttcacgcactgatcggccag
aacggtgcgggaaaatcgacccttatcaaggtgttgaccggctatcaccggcgcgatgcg
ggtgaagtgacattcgatggcaaacccttcgaagtcttctcgccgcagcaggcgcaggcc
agcggcatcagcaccatctatcaggaaatcaacctcgttccctactgctccatcaccgag
aacatctgtctcggtcgcgaagcccgccgttacggcctgctcgactggaaccgcatgcac
cgggaggcggaaacgctgctgcagcgcttcaacgtgcgcgtcgacgtgcatcgccccttg
atggaattcaacacagccacccagcagatggtggccattgcccgcgccatcggcttctca
gcaaagctcgtcatcatggacgaacctacctcctccctcgacgagcgcgaggtttccgtt
ctctttgatgtcattcgtcagctgaagcaggagggcgtttcggtggtcttcgtcagccac
aagctcgacgagctctataaggtttgcgaccgtgtcaccatcatgcgcgatggcaggacc
gtaaagacggcctccatgaacgagattgacaagatcggtctcgtttcttccatgcttgga
cgggccatcaagcgcgccgagggccatgccaccgccttcagcgaccgcgatcagaagaag
atcggcaaggtgctcttttccgccgagaacctggcgatcaatcagacagtacaggacgta
tcatttaatgttcgcagcggtgagatcgccggatttgccggcctcctcggtgccgggcgc
accgaaacggcccgcctcgtgttcggcatcgaccggccgcgcgcgggcacgatgtattat
gacgggcggaagttcgatccgcgcaatccctccgacgccatcgtcgcggggatgggcttc
tgtaccgaagatcgcaagagcgaaggcattgttccggagatgagcgttgcggaaaacatg
atgctggcactgatgccgaaattgagcaactccggcatcatcgacgagaaggcgcaacgc
gacatcgtcgagcggttcatcaggcagcttgggatcaaatgttcgggaccggatcagaaa
gtgcgcgagctctccggcggcaaccagcagaaggtgctccttggccgctggctggcaatg
aatccgcgcctgctcattcttgatgaaccaacccgcggcatcgatgtcggcgccaagggc
gagatccaatcgctgatcaagtcgcttgccgatcaagggctctcggtgttgatgatctcg
tcggaactggaagaggtgatcgagggtgccgaccgggtgtttgtgctgcgtgaaggcgtc
agcgtcgccgagtttgatcgcgatcgggccactgaggatactttgatgtcggccatggcc
cacggcagtgcgcctcatagtgcggggacggtatcgtga

DBGET integrated database retrieval system