KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM014910
Entry
Phum_PHUM014910   CDS       T01223                                 

Name
(RefSeq) cAMP-dependent protein kinase catalytic subunit, putative
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04144  Endocytosis
phu04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Phum_PHUM014910
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    Phum_PHUM014910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phu01001]
    Phum_PHUM014910
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phu04147]
    Phum_PHUM014910
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     Phum_PHUM014910
Protein kinases [BR:phu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   Phum_PHUM014910
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Phum_PHUM014910
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Kdo ABC1
Other DBs
NCBI-GeneID: 8233762
NCBI-ProteinID: XP_002422801
VectorBase: PHUM014910
UniProt: E0V9K7
AA seq 695 aa
MADLEAVLADVSYLMAMEKSKCTPAARASKKILLPDPSVRSVMHKYLEKKGEVNFDKIFN
QILGYLLFKDFCENCCEEPVPQLRFYEEIKAYEKLECMEERKKLAREIYDNFIMKELLAH
SHDYSKDSVAHVQKFLMKNEVPVNLFEPYIEEIFNHLRGEPFKKFLESDKYTRFCQWKNL
ELNIQLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGIDCPFIVCMTYAFHTPDKLFFILDLMNGGDLHYHLSQHGVFNEPEMKFYAA
EVILGLEHMHRRYIVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAP
EVLSKGTAYDSSADWFSFGCMLYKLLKGHSPFRQHKTKDKHEIDRMTLTMNVELPESFSR
DLRSLLEGLLQRDVDKRLGCKGNGADEVKEHSFFNGIDWQQVYLQKYTPPLIPPRGEVNA
ADAFDIGSFDEEDTKGIKLTEADQDLYKNFPLVISERWQGEVAETVFETINQEADKAEQK
KKAKQKLKFDADEKESDCILHGYIKKLGGPFASAWQTRYAKLYPNRLELHPESGNTKPEL
IFMDQIEDVSPDMVQVKSEQCIVVRTKIGKVVLTNPDEIGLKEWALSLRSAHKRSLELLG
SMAKKAGKIYGTDEKQGNNKNMTMISTGTRNTNGN
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggcggatttagaggccgtgctcgcagatgtgagctatttaatggccatggaaaaaagc
aaatgtacaccagccgcgagagcgagcaaaaaaatattactgccggatcccagcgtgcga
agcgttatgcacaagtacctggaaaaaaagggcgaagttaactttgataaaattttcaat
caaattttaggttatcttctttttaaagatttttgtgaaaattgttgcgaagaacctgta
cctcaattaagattttacgaagagattaaagcttatgaaaaattagaatgcatggaagaa
aggaaaaaattagcccgggaaatatacgacaattttattatgaaagaattactggcgcat
tcccacgattattctaaggattcagtcgcgcatgtacaaaaatttttgatgaaaaatgaa
gttccagttaatttattcgagccttacatagaagaaatattcaatcatttaagaggggag
ccgtttaagaaatttttggaaagcgataaatacacgagattttgtcagtggaaaaaccta
gaattgaacattcagctgacaatgaacgatttcagcgttcacagaataatcggacgaggg
ggttttggagaagtttacggttgccgaaaagcagacaccgggaaaatgtatgccatgaaa
tgtctggataaaaaaaggataaaaatgaaacagggagaaactttagcattaaacgaacgt
atcatgttgtccctcgtgagcacgggcatcgattgtccttttattgtttgcatgacctac
gccttccacacgcctgacaaattgtttttcatattagatctcatgaatggcggagatctt
cattatcatttgtcgcaacacggagtttttaacgagccggaaatgaaattttacgccgcc
gaagtcattttaggtttggaacacatgcatcgaaggtatatagtatatagagatttaaaa
ccagcgaatatattattagacgaacatggacacgttcggatttcagacctcggtttagcc
tgtgatttttccaaaaagaaacctcatgcgagcgtcggaactcatggatacatggcgcct
gaagttctatcgaaaggaactgcatacgattcatcagccgattggttttccttcggttgc
atgctttataaattacttaaaggtcacagtccttttagacaacataaaacgaaagacaaa
cacgaaattgatagaatgactctgacgatgaacgtcgaacttccagaatcgttttctagg
gatcttagaagtttgctagaaggtttacttcaaagagatgttgataaaagactgggatgt
aaaggaaacggagctgacgaagttaaagagcattcattttttaacggtatcgattggcag
caagtttatttacaaaaatatactcctcctttgataccaccaagaggagaagttaatgcg
gcagatgcttttgatatcggttcgttcgacgaagaggatacaaaagggatcaagttaacc
gaagccgatcaagatttgtataaaaattttccattggttatatcggagaggtggcaggga
gaagttgccgagactgtttttgaaacgattaatcaggaagcagataaagccgagcaaaag
aaaaaagcaaaacaaaagctcaaatttgacgcggatgaaaaagaatcggattgcattctt
cacggatatataaaaaaattaggaggtccttttgcatccgcttggcaaacacgatatgca
aaattgtaccccaacagattagagcttcatccggaatcgggtaacacaaaacccgaactc
atattcatggatcaaatcgaagatgttagcccggatatggttcaagtgaaaagtgagcaa
tgcatcgtcgtaagaacgaaaataggaaaagtcgttttaacgaatccggacgaaatcggt
ctcaaagaatgggctttatcgttaagatcggctcataaacgttctctagaactattagga
agcatggcaaaaaaggctggtaaaatatatggaaccgatgaaaaacaaggaaacaataaa
aacatgacgatgatatcaacgggcaccaggaacacaaatggaaattaa

DBGET integrated database retrieval system