KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM018540Help
Entry
Phum_PHUM018540   CDS       T01223                                 

Definition
(RefSeq) Heat shock 70 kDa protein cognate, putative
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu03040  Spliceosome
phu04141  Protein processing in endoplasmic reticulum
phu04144  Endocytosis
phu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Phum_PHUM018540
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Phum_PHUM018540
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Phum_PHUM018540
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Phum_PHUM018540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:phu01009]
    Phum_PHUM018540
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:phu03041]
    Phum_PHUM018540
   03009 Ribosome biogenesis [BR:phu03009]
    Phum_PHUM018540
   03110 Chaperones and folding catalysts [BR:phu03110]
    Phum_PHUM018540
   04131 Membrane trafficking [BR:phu04131]
    Phum_PHUM018540
   03051 Proteasome [BR:phu03051]
    Phum_PHUM018540
   03029 Mitochondrial biogenesis [BR:phu03029]
    Phum_PHUM018540
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phu04147]
    Phum_PHUM018540
Protein phosphatases and associated proteins [BR:phu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Phum_PHUM018540
Spliceosome [BR:phu03041]
 Complex B
  Other components
   Prp19 complex
    Phum_PHUM018540
 Complex C
   Prp19-CDC5 complex
    Phum_PHUM018540
Ribosome biogenesis [BR:phu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Phum_PHUM018540
Chaperones and folding catalysts [BR:phu03110]
 Heat shock proteins
  HSP70 / DNAK
   Phum_PHUM018540
Membrane trafficking [BR:phu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    Phum_PHUM018540
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Phum_PHUM018540
Proteasome [BR:phu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Phum_PHUM018540
Mitochondrial biogenesis [BR:phu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    Phum_PHUM018540
Exosome [BR:phu04147]
 Exosomal proteins
  Proteins found in most exosomes
   Phum_PHUM018540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464 DUF3813
Motif
Other DBs
NCBI-GeneID: 8233806
NCBI-ProteinID: XP_002422844
VectorBase: PHUM018540
UniProt: E0V9N7
AA seq 660 aa AA seqDB search
MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTETERLIGDAAKNQVA
MNPNNTIFDAKRLIGRRFDDATVQSDVKHWPFTVVNDGGKPKIQVQYKGENKTFFPEEIS
SMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDSGAIAGLNVLRIINEPTAAA
IAYGLDKKTAGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV
NHFVQEFKRKYKKDLQTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSIT
RARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKE
LNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVAPLSLGIETAGGVMTTLIKRNT
TIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQVEVTF
DIDANGILNVTACEKTTGKENKITITNDKGRLSKEEIERMVNEAEKYKAEDEKQKATISA
KNALESYCFNMKSTIEDEKIKDKISDSDKQTIQDKCNDIIKWLDANQLAEAEEYEHKQKE
LEGICNPIITKLYQAAGGMPGMPGGMPGGMPGGMPGGFGAGGAAPGGAPGAGGPTIEEVD
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcacctgcagtaggaattgatcttggcacaacatattcatgtgttggagtg
tttcaacatggtaaagttgaaatcattgctaacgatcaaggaaataggacaactccatct
tatgttgcttttaccgaaaccgaacgtctcattggagacgctgccaaaaatcaagtggca
atgaatccaaataacaccatttttgatgccaaaagattgatcggaagaagatttgatgat
gctaccgttcaaagtgatgtcaaacattggccatttacagtggtcaatgatggcggtaaa
cctaagattcaagtacaatacaaaggtgaaaacaagacctttttcccagaagaaatcagt
tcaatggtactcacaaaaatgaaggaaacggctgaagcttatttaggaaaaaccgttact
aacgccgtcatcactgttcctgcttactttaatgattcccaaaggcaagccaccaaagat
tccggagccatcgctggtttaaatgttttacgtattattaacgaacccacggctgctgcc
atagcctacggtttggacaagaaaacagctggaacgggagaaaggaacgtcctcattttt
gatttgggtggcggtacctttgatgtttccatcttgaccattgaagatggtatttttgaa
gtaaaatccactgccggagacacacatttgggaggagaagatttcgacaacagaatggtc
aatcatttcgtgcaagagtttaagaggaaatacaagaaagatttgcaaaccaacaagaga
gcattgagaagattgcgtactgcttgcgaacgtgctaagagaactctttcttcatccaca
caagccagcattgaaatcgattcgttgtttgagggtgttgatttctacacttcgattacc
cgagctcgttttgaagaattgaatgctgatctcttcagatctaccatggaacctgttgaa
aaatctctacgagacgctaaaatggacaaagctcaaatccatgatattgtacttgtcgga
ggatcaactagaattccaaaagtccaaaaactacttcaagacttcttcaacggcaaagaa
ctcaacaaaagtattaatccagatgaagccgttgcttatggagctgctgttcaagctgct
attttgcatggtgataaatcggaagaagttcaagatcttttgcttcttgacgttgcacca
ttgtctttgggtattgaaactgccggaggtgttatgacaactctcatcaaaagaaacaca
accattccaaccaaacaaactcaaacattcacaacttactccgacaaccaacccggagta
cttattcaagtttacgaaggagaaagagctatgacaaaagacaataatcttcttggaaaa
ttcgaattgacaggcattccaccggctccgcgaggagtcccacaggttgaagtaacattc
gatatcgacgctaacggtattttgaacgttactgcctgcgaaaagacgaccggtaaagaa
aacaagatcaccattaccaacgacaagggtcgtttgtctaaagaagaaatcgagagaatg
gtcaatgaggccgagaaatacaaagcagaagatgaaaaacaaaaggccaccatttcagcc
aagaacgctcttgaatcttactgtttcaatatgaagagcacgatcgaagatgaaaaaatc
aaggacaagatttcggactccgacaagcaaaccattcaagacaaatgcaatgacatcatc
aaatggctcgacgctaatcaacttgccgaagccgaagaatacgaacacaagcaaaaggaa
ttggaaggcatttgcaatccgatcatcaccaaattataccaagcagctggaggaatgccc
ggaatgcctggaggtatgccgggtggtatgccaggtggaatgccaggtggcttcggagcg
ggtggtgccgcgcctggtggtgcacctggagccggaggcccaaccattgaagaagttgat
taa

DBGET integrated database retrieval system