KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM044580
Entry
Phum_PHUM044580   CDS       T01223                                 
Name
(RefSeq) ubiquitin-conjugating enzyme morgue, putative
Organism
phu  Pediculus humanus corporis (human body louse)
SSDB
Motif
Pfam: UQ_con F-box-like F-box F-box_4
Other DBs
NCBI-GeneID: 8232626
NCBI-ProteinID: XP_002423235
VectorBase: PHUM044580
UniProt: E0VAU1
AA seq 397 aa
MSSVDVDLVNDNNCREDSKNGLVSLPENSVFNEEYDFPKSVCHTCNGYYGPCFGEPICAT
CHAFLFPETLTCGYFEVDTLFEFHTDDSDSGNDEPTDSFNFLDRRDKMFRRSQRCQNKKR
SPHQKFDLLAQQIIFLTTPRGSDDISLDIVQCLPAEVLFVVFSYLDDLSLCCVGNVCKRW
RNLLKTQISDESWKEYTLKRWPLFKPVVSHGNWFKLYTRLVESSPCRTCLQVMWNQTNSK
AEEYSWRKNRLRYELRSLQTDPLEGIQITPLDFACFHWQATITGPVGSPYEGGLFYLHIH
VPNGYPLCPPIVKFLTKVFHPNVSRHGDVGIDSLQHNWSLALTISKVLISVQSLLTDPYC
HVCMEPEIGSLYLSDKETFERIARAWTWKYAMHDYLK
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtctagtgttgatgttgacttagttaatgacaataattgtagggaagattcaaaaaat
ggtttagtaagcttaccagaaaattcagtttttaatgaagagtatgatttcccgaaatcc
gtttgccatacatgcaatggctattacggcccttgctttggtgaaccaatttgtgctacc
tgtcatgcatttctttttcctgaaactttaacttgtggatatttcgaggtagacacgtta
tttgaattccacacagatgacagtgattctggaaatgatgaaccgacggattcatttaat
tttctcgaccgacgggataaaatgtttcgtcgttcacaacgctgtcaaaataaaaaacga
agtcctcatcaaaaatttgacttattagcccaacaaattattttcttaacaacaccgagg
ggatctgatgatatttcattagatattgtgcagtgcttacccgcagaagtgttgtttgtt
gttttttcgtacctggacgatttatcactatgttgcgtcggtaatgtatgtaaaagatgg
agaaatttattaaaaactcaaattagtgatgaatcatggaaagaatatactttaaaaagg
tggcctctattcaaacctgtcgtttcacacggtaattggtttaaattgtatactcgttta
gttgaaagttcaccttgccgaacttgcttacaagtgatgtggaatcaaactaattctaaa
gcagaggaatattcgtggaggaagaatagactcagatatgaattaagaagtcttcaaact
gatcctttagaaggtattcaaatcacgccattagattttgcatgttttcattggcaagcc
accatcaccggccctgttggaagcccttatgaaggtggacttttttacttacatatacat
gttccaaatggttatcctctttgtcctccgattgttaaatttttaaccaaagtatttcat
cccaatgtatcaaggcatggcgatgttggaattgattctctgcagcacaattggagtttg
gcattgactatatctaaagttcttatatcagtgcaaagtttattaactgatccatattgt
catgtatgtatggaacctgaaatcggttcgttatatttatcagataaagaaacttttgaa
agaattgccagagcatggacctggaaatatgcaatgcatgattatttaaaataa

DBGET integrated database retrieval system