KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM065530Help
Entry
Phum_PHUM065530   CDS       T01223                                 

Definition
(RefSeq) mitogen-activated protein kinase ERK-A, putative
Organism
phu  Pediculus humanus corporis (human body louse)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 8231110
NCBI-ProteinID: XP_002423526
VectorBase: PHUM065530
UniProt: E0VBN2
AA seq 358 aa AA seqDB search
MTGSANFESCVELTKQAHNYEDLALIGNGAYGTVYKAKNKTNGHIVAMKKIRVHLCEDGG
LPPSTLREIAMLKQVDQYEHPNIVRLLDVCYGPRLEEYLVLFIVFEHMEQDLSQFISNCP
APGIGVNRIKDLTFQLLSGVDFLHTHRIIHRDLKPQNILVSCDGQYLKLADFGLAKVYEF
ESSLTSVVATLWYRPPEVLLRDTYATPLDVWSCGCIMAELYRRTPLFPGVTEGDQLGKIF
DIIGTPSESEWPQNTSLLRSSFPHSPGIDLEAVVPEICGHGKDLLQRMLRFEQHKRITAC
EALNHPYFKDFGYVPLEIGTSLNQSTSSASNASTPVSVNSCKCCSCDDSRTSTESPDK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacgggatctgcaaatttcgaatcatgcgtggagttaacgaaacaagcccacaattac
gaagatttggccctaattggaaacggagcgtacggaaccgtttacaaagcgaaaaacaaa
acaaacggtcacatagttgcgatgaaaaaaattcgagttcacttatgcgaagatggtgga
cttccgccttctacactacgagaaatagccatgttgaagcaagttgaccaatacgaacat
ccaaatatagtcagattattagatgtttgttacgggccaagactggaagagtatttagtt
ttgttcattgttttcgaacacatggaacaagatttatcacaatttataagtaattgtccg
gcgccagggatcggtgttaatagaattaaggatttaacgtttcaacttttatcgggagtc
gattttcttcacacgcataggataatacatagagatttaaaaccacaaaatatattggtg
agctgcgacggacagtaccttaaattggccgatttcggtttggctaaagtttacgaattc
gaatcgagtttgacaagcgttgttgccactttgtggtatagaccgccggaagtacttcta
agagacacatatgccacgcctttggatgtttggtcgtgcggttgcataatggccgaacta
tacaggagaacgccattgtttcccggagttactgagggtgatcaattaggaaaaatattc
gacattatcggaacgccgagcgaaagcgaatggccacaaaatacgtctctgttaagatcg
tcttttccgcacagtcccggaatcgatttggaagccgtggtaccagaaatatgcgggcac
ggcaaggatttgcttcaacggatgctgaggttcgaacagcacaaacgtataacggcttgc
gaagcgttaaatcatccgtactttaaagatttcggttacgtaccattagaaataggaact
agtctcaaccaaagcacatcgtcggcgagcaacgcatcgacacccgtttcagttaacagt
tgtaaatgttgcagctgcgacgattcgagaacatcaacggaaagtccagacaaataa

DBGET integrated database retrieval system