KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM067370Help
Entry
Phum_PHUM067370   CDS       T01223                                 

Definition
(RefSeq) hypothetical protein
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Phum_PHUM067370
Enzymes [BR:phu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Phum_PHUM067370
Transcription machinery [BR:phu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Phum_PHUM067370
Chromosome and associated proteins [BR:phu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Phum_PHUM067370
   HAT complexes
    PCAF complex
     Phum_PHUM067370
    STAGA complex
     Phum_PHUM067370
    TFTC complex
     Phum_PHUM067370
    SAGA complex
     Phum_PHUM067370
    SLIK complex
     Phum_PHUM067370
    ADA-HAT complex
     Phum_PHUM067370
    HAT-A2 complex
     Phum_PHUM067370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 8231146
NCBI-ProteinID: XP_002423562
VectorBase: PHUM067370
UniProt: E0VBR8
AA seq 805 aa AA seqDB search
MTDPNLSKNVSELAGVGSSGFSNQQPDESQQQQPPDQVNQKQSNLLRIQQRKQQVYNWPN
HKKLLKLAVYSACQAEECLCTGWKTTPAPTQTLASNDTPCRNCTHILEQHISHLRMVPDP
EINRLLGMVVDVENIYMSMQKEEDPDTKRVYFYLFKLLRKCIVTMTKPTIEGPLGQPPFE
RPSIAKAVTNFVLHKFGHLAQREWQTMYELAKMFLHCLNNWNYESPSIRRNVAAPEATSA
YKINYTRWLVFCHVPAFCDSLPHFDTTVVFGRKLLRAVYKSVCRQLIDKCHAERDRMQTE
NRILILTHFPKFLSLLEEEIYAPNSPIWDPEFRQVPPAHIQAVFDAKAAAAAAGRKVGEF
EKLTAPPNEKDNFTTFNVTPGVGRKGTSQKSDGEKRSGESTSGRPEKKRKQEEYVDDVSE
NTIAEILATIEDGKGNAGPQAVFPENAPRDEAAKQEEARGIIQFQVVGNSLTQSVSKQTM
LWLIGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKGGRAIGGICFRTFASQGFVEIV
FCAVTSNEQVKGYGTHLMNHLKDYFINHNILHFLTFADEFAIGYFKKQGFSKDIKLNRNI
YQGYIKYYERATLMHCQLNPTIVYTEFTAIIRKQKEIVKKIIEQRNQEVQKVHQGLTCFK
EGVRGIPIEAIPGIRETGWKPAARTTRISRVTSEPNDPDTLCSALTGVYNAVKNQSHAWP
FLKPVDKNEVPDYYHHIKYPMDLKTMGERLRSGYYHSRRLFIADMTRVFTNCRLYNSPDT
EYYRCANNLEKYFQTKMKEIGLWDK
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgacagatccaaacttgtcaaaaaatgtcagcgaacttgctggagttggtagctcaggt
tttagtaatcaacaacctgatgaaagccaacaacagcaacctcctgaccaagtcaatcag
aagcaaagcaatttgcttaggattcaacaaagaaaacaacaagtatataattggcccaat
cataaaaaattattgaaattagctgtatactctgcttgtcaggctgaagaatgcctgtgt
acaggttggaaaactactccagctcctactcaaactttagccagcaatgatacaccttgt
aggaattgcacccatattttggaacaacacatatctcatcttcgaatggttcctgatcca
gaaattaataggctcctcggaatggttgtcgatgttgaaaacatttacatgtcgatgcaa
aaagaagaggatcctgatacaaaaagagtttatttttatttatttaaattacttaggaaa
tgtatagtcacaatgacaaaaccaaccatagagggtcctcttggccagccaccatttgaa
cgaccaagtatagccaaagccgtcacaaattttgttttgcacaaatttggtcacttggcc
caaagggaatggcaaacaatgtatgagttagctaaaatgtttcttcactgtttaaataat
tggaattacgaaagtcccagcattagaaggaatgtcgcagctcctgaagcaacttctgca
tataaaattaattacactagatggctagttttttgccatgttcctgctttttgtgattcc
ttgcctcatttcgataccacagtagtatttggcagaaaattattaagagctgtttataaa
tctgtttgtcgtcagttaattgataaatgtcatgctgaaagagacagaatgcaaacagaa
aatagaattctcatccttactcattttcctaagtttttatcattattggaagaagaaatt
tatgctcccaattcccctatatgggatcctgagtttaggcaagttccacctgcacacata
caagctgtatttgatgcgaaagctgcagcagcagcagcaggacgaaaagtaggagagttt
gaaaaactaactgctcctcctaatgaaaaagataattttactacttttaacgtaacccct
ggagtcggtagaaaaggaacatctcaaaaatctgatggtgaaaaaagatcaggagaatcg
acatctggccgaccagaaaagaaacgaaaacaagaagaatatgttgatgacgtttcggaa
aataccattgccgaaattttggctaccatagaagatggtaaaggaaacgctggcccccag
gctgtttttccggaaaatgcaccgagagacgaagcggccaaacaagaagaagctcgagga
ataatacaatttcaagttgttggaaattcattgacacaatccgtttcgaaacaaacaatg
ctttggcttatcggtcttcaaaatgttttttctcatcagttaccacgaatgccgaaggaa
tatatcacaagattggtattcgacccaaaacacaaaactttggctcttatcaaaggaggg
agagcaatcggaggaatatgtttcagaacttttgcttctcagggttttgtcgaaatagta
ttttgtgccgttacgtcgaacgaacaggtcaaaggttacggaactcatttaatgaatcat
ttaaaagattattttataaatcacaacattttgcattttcttacatttgcagacgaattt
gccatcggttattttaaaaagcagggtttttccaaagacattaaattaaatagaaacata
tatcaaggttatataaaatattacgaaagagcaaccctcatgcactgccagttgaatccg
accattgtttacacggagtttactgcgataataagaaaacagaaggaaatcgttaaaaaa
attatcgaacaaagaaatcaggaggttcaaaaggttcatcaaggtttgacttgttttaaa
gaaggagtgcgtggcattccaatcgaagccataccgggaatcagagaaaccggatggaaa
cctgctgccaggacaacgagaatcagtagagttacttcagaaccaaacgatccggatact
ctttgcagtgcacttaccggagtgtacaacgcagtcaaaaatcaaagtcacgcatggcca
tttttaaaacccgtcgataaaaatgaagtacccgattattatcatcacataaaatatccc
atggatttgaaaacgatgggagaaagattgaggagcgggtattatcattcgagaagatta
ttcattgccgacatgacgagagtttttacaaattgcagattgtataattcaccagatact
gagtattataggtgtgcaaataatttagaaaaatattttcaaacgaaaatgaaagaaata
ggactctgggacaaataa

DBGET integrated database retrieval system