KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM074050
Entry
Phum_PHUM074050   CDS       T01223                                 

Name
(RefSeq) Ecdysteroid-regulated 16 kDa protein precursor, putative
  KO
K13443  Niemann-Pick C2 protein
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:phu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    Phum_PHUM074050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:phu02000]
    Phum_PHUM074050
Transporters [BR:phu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Phum_PHUM074050
SSDB
Motif
Pfam: E1_DerP2_DerF2
Other DBs
NCBI-GeneID: 8231263
NCBI-ProteinID: XP_002423602
VectorBase: PHUM074050
UniProt: E0VBV8
AA seq 159 aa
MEVKSVLSVIAIFLFLIIGFGNAEECLRGPALKQNNRVTLSNCEKPPCILKKKTTTTVDL
KFTPKQDVNKMTNSVHALILGVPFPFIGVDGENVCDKIYDAKSGDKTSCPLKAGNEYLYK
DQFKILDVYPKINVNVHWALKNEKDQDVLCFEVPAKIVR
NT seq 480 nt   +upstreamnt  +downstreamnt
atggaagtaaaatcagtattatcagttatcgcgatttttttatttttaattattggattt
ggtaatgcagaagaatgtcttcgtggtccggcattaaaacaaaataatagagttacactt
tcgaattgtgaaaaaccaccgtgcatattaaaaaagaagacaacaacaacggtcgatctt
aaatttacaccaaaacaagatgttaataagatgacaaattccgtacacgctctcatactt
ggtgttccatttccgtttatcggagtcgatggtgaaaatgtttgtgacaaaatttacgat
gctaaatcaggtgataagacgtcatgtccgttaaaagccggaaatgaatatctttataag
gatcaatttaaaatattggatgtttatcccaagataaatgttaacgttcattgggcattg
aaaaatgaaaaagatcaagatgttctctgtttcgaagttccagctaaaattgtacgataa

DBGET integrated database retrieval system