KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM087560Help
Entry
Phum_PHUM087560   CDS       T01223                                 

Definition
(RefSeq) hypothetical protein
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    Phum_PHUM087560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phu01001]
    Phum_PHUM087560
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phu03036]
    Phum_PHUM087560
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     Phum_PHUM087560
Protein kinases [BR:phu01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   Phum_PHUM087560
Chromosome and associated proteins [BR:phu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Phum_PHUM087560
   Centrosome duplication proteins
    Regulators of centriole replication
     Phum_PHUM087560
  Sister chromatid separation proteins
   Polo kinases
    Phum_PHUM087560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 Pkinase_fungal Kinase-like RIO1 Kdo APH
Motif
Other DBs
NCBI-GeneID: 8231654
NCBI-ProteinID: XP_002423831
VectorBase: PHUM087560
UniProt: E0VCI7
AA seq 948 aa AA seqDB search
MLYVLIYQLKMAVLNCLYKLCQLNKRNNAANMDNPLGFGIRIEDYEVGPFLGKGGFATVY
KAKCLRTQLIIDKKSMFAAGMISRVKQEVSIHSKLKHPSVLELYCFFEDCNYVYLVLEYC
ENGELQRFLRQQNKVLSECEAYEVLQQVIDGLKYLHSHNIVHRDLTLANLLLTRNMKIKI
ADFGLATQLMAPNETHMTMCGTPNYISPEVATRSCHGLQVDVWGLGVMLYTLLVGKPPFD
TSAVKSTLTKVVMSDYKEPENLSSEAKDLISNLLEKNPKDRLTLPDILKHPFMMKYSHNR
ILNFMNDSIDSGQYTMSTNTNNSQKSLTNLKNLSVRGDEDFRSKYKNSQVTSRPLETPDL
KRTHQDINTESLFPNSNNGPHVFEHLPRQCFSNYQNKCGSEHPCNQQSSNFHNRIFSTGT
DNNFIVENPCLRKSNSLSNIAKQSNPIYRENSETAFSDIRHNANCGKTLNSLCHCVEKFK
KVVDTHCCTNIQEEEEVRKNNMIHGCDAHGSMQGKECNQFIQNSCCSGSQYRNNCSQNKV
IYANQHSVNSENVDCIKSSSVLLSENKFTSGEKNSYPSPESCRIVIDGVKVLPINSERLQ
PARHKTNKAVLSITESGEVVIEFLKRKGKEEKVVDCCRISKDGIRVVVYSVNKPLKDKPP
DLPELGTDGIYSYENLPQKHWKKYLYASRFVNLVKAKTPKITFYSDQAKCLLMENSPDDF
EVMFYSGGKISKNGKIVKIINESGSLSSYQMSDMTSGNNNSNLNVQHFLQCYQHCLKLEK
TLQDMTSFGNKSLSCFPIIVGRKPSSCGNIFSAKENTCHSSNSGFSNLTSNHGFLTSVTP
YQSRAQSTPKNKKRSDSGISRRIRVAGLGVAVQFPNGAIEIEYLDGSKLLFNSNSGEIIF
SDSKNTAIKYNQKESIPDWLRYKLKDITKVIPYLINQDSVLPNPKLIR
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgttatacgttttaatttatcagttaaagatggcagttttaaactgtttgtataagttg
tgccaacttaacaagcgaaataacgccgcgaatatggataatcctttaggatttggaatt
aggatcgaggactacgaagtaggaccttttctaggaaaaggaggatttgcaactgtgtac
aaagctaaatgtttaagaactcaattaattattgataaaaaatcaatgtttgctgctgga
atgatatcgagagtgaagcaggaagtttctatacattcaaaattaaaacatccctctgtt
ttagaactttattgttttttcgaagactgtaattatgtttaccttgttttagaatattgc
gaaaatggtgaacttcaaagatttttaaggcaacaaaataaagtcttatcagaatgtgaa
gcttatgaggtccttcaacaagttatagacggattaaaatatttacattcgcacaacatt
gttcatagagatctaacattagccaatttacttttaaccagaaacatgaaaattaaaata
gcagattttggtctggctactcaattaatggcaccaaacgaaactcatatgaccatgtgt
ggaacgcccaattacatatcacccgaagtagcgactagaagttgtcatggacttcaagta
gatgtgtggggtcttggagttatgttgtacacattattagttgggaaacctccatttgat
actagtgcagttaaaagtactttaactaaagtagttatgtcagattataaggaacctgaa
aatttatcttctgaagctaaagatttgattagtaatttattagaaaaaaatcccaaggat
agattaacattaccagatattttaaaacatccatttatgatgaaatattctcataatcga
atattaaattttatgaatgattccattgacagtggtcagtatacaatgtcaaccaataca
aataattcgcaaaaaagtttgacgaatttaaaaaatttgtcagttcgcggtgacgaggat
tttcgttccaagtacaaaaattcacaggtcacgtccaggcctttagaaacgcctgatttg
aaaagaacgcatcaagatatcaatacagaatctttatttcctaattcgaataatggtcca
catgtttttgagcatcttcctcgtcagtgtttttcaaattatcagaataaatgtggttca
gaacatccatgtaatcaacaatcgagtaattttcataatcgaattttttccaccggaact
gataataattttatcgttgaaaatccctgcttacgaaaatctaacagtttgtcaaatatc
gcaaaacaaagtaatcccatttatcgagaaaatagtgagacagcattttcggatattcgt
cataatgcaaattgtgggaaaaccctaaatagtttatgtcattgcgtggaaaagtttaaa
aaagtcgtcgatacccattgctgcacgaatattcaagaagaagaagaagtcagaaaaaat
aacatgattcacggttgcgatgctcacggtagcatgcaaggaaaagaatgtaatcaattc
attcaaaattcatgttgttcggggagccaatacaggaacaattgcagtcagaacaaagtt
atttatgccaatcaacattctgtaaattcggaaaatgtcgattgcatcaaaagttcatct
gttttactgtcggaaaataaattcacatccggcgaaaaaaattcatatccttcgcccgaa
tcgtgtcgaatcgtaatcgatggagtaaaagttttacccattaattcggaaaggttacaa
cctgccagacataaaacgaacaaggctgttttaagtataaccgagtctggagaagttgtt
attgaatttctcaagaggaaaggaaaggaagaaaaagtcgtggactgttgtagaatttca
aaagatggaatcagggtcgtcgtttattcagttaacaaaccgttaaaggataaacctcct
gatttgccagaattaggaacggatggaatatacagttatgaaaaccttcctcaaaaacat
tggaaaaaatatttgtacgcgtctcgtttcgttaatttagtcaaagcgaaaactccaaaa
ataactttttacagcgatcaagctaaatgtttgcttatggaaaattcaccggatgatttc
gaagtcatgttttattccggaggaaaaataagcaaaaatggaaagattgttaaaatcatt
aacgaatccgggagtttaagcagttatcaaatgtcggatatgacgagtggaaataataat
tcgaatcttaacgtgcaacattttcttcaatgttatcaacattgtttgaaattggagaaa
acgttacaagacatgacgtcattcggaaacaaatccctgagttgttttccaatcatcgta
ggaagaaaaccaagttcctgtgggaatatattcagtgcaaaagaaaatacctgtcattcg
agtaatagtggattttcaaatttaacaagcaatcatggatttctcacatcggtaacacct
tatcagtccagagctcagagtacgccgaaaaataaaaaacgttcagattccgggataagt
cgcagaattcgagtggctggattaggagttgccgtccagtttcctaatggagccatagaa
atcgagtatttggacggttcgaaacttttattcaattcgaattcgggcgaaataatattt
tccgattcgaaaaatacggcaattaaatacaatcaaaaagaatccatacccgattggctt
agatataaattaaaagacataacaaaagtcataccatatttaataaatcaagattctgta
ttaccaaatcctaaattaattaggtag

DBGET integrated database retrieval system