KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM095410
Entry
Phum_PHUM095410   CDS       T01223                                 
Name
(RefSeq) syntaxin-1A, putative
  KO
K04560  syntaxin 1A
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    Phum_PHUM095410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phu04131]
    Phum_PHUM095410
Membrane trafficking [BR:phu04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    Phum_PHUM095410
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Branch Lzipper-MIP1 Baculo_PEP_C DUF6664 TraF_2 ISG65-75 Prominin DUF1910
Other DBs
NCBI-GeneID: 8238030
NCBI-ProteinID: XP_002423912
VectorBase: PHUM095410
UniProt: E0VCR8
AA seq 283 aa
MTKDRLAALQAAQSDDEEGGNDDVQVNMEGRDGFMDEFFSEVEEIREMIDKIQANVEEVK
KKHSAILSAPQTDEKVKQELEDLMADIKKTANKVRAKLKVIEQNIEQEEHTNRSSADLRI
RKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRTTTNDELEDMLEQGNPA
VFTQGIIMETQQAKQTLADIEARHADIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEY
HVEHAVDYVQTATQDTKKALKYQSKARRRKTKLKFKICWHSVI
NT seq 852 nt   +upstreamnt  +downstreamnt
atgactaaggacagattggcagctttacaagctgctcaaagtgatgatgaagaaggagga
aatgatgatgttcaagttaatatggaggggagagatggatttatggatgagtttttttcc
gaggtggaggaaatacgagagatgatagataaaattcaagctaatgtcgaagaagtcaaa
aagaaacatagtgcaatactttcggcacctcaaacggatgagaaggtgaaacaagaatta
gaagatctaatggctgacataaaaaaaactgccaataaagtccgtgccaaattgaaggtg
atagagcaaaacatcgagcaagaagaacacacgaacagatcatcagccgatctgaggata
cgaaaaacacaacactcgactttgtcacggaagtttgtcgaagttatgacggaatataat
cgaactcagacggattatagggagaggtgtaaagggagaatacagaggcagttggaaatc
acgggaagaacaacgacgaatgacgaattagaagatatgttagaacaagggaatcccgcg
gtttttactcaagggataattatggaaacgcagcaagcgaaacaaacattagctgacata
gaagcgaggcatgcggatattattaagctagaaaattctattcgtgagcttcacgacatg
tttatggatatggcgatgttggtggaaagtcaaggagaaatgatagatcgtatagaatat
catgtagaacacgcggtagattacgtacagacggctactcaggataccaaaaaagcgttg
aagtatcaaagtaaagctcgccgtagaaaaacaaaattgaaatttaaaatttgttggcat
tctgtcatatga

DBGET integrated database retrieval system