KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM100000
Entry
Phum_PHUM100000   CDS       T01223                                 

Definition
(RefSeq) Speract receptor precursor, putative
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00230  Purine metabolism
phu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Phum_PHUM100000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phu01001]
    Phum_PHUM100000
Enzymes [BR:phu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     Phum_PHUM100000
Protein kinases [BR:phu01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   Phum_PHUM100000
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase Peripla_BP_6 HNOBA
Other DBs
NCBI-GeneID: 8238092
NCBI-ProteinID: XP_002423972
VectorBase: PHUM100000
UniProt: E0VCX8
AA seq 1153 aa
MWIICLSIASVISLSSTEEYVLGYLTGSQRKPGDLEYSRPGLRISGAISYAVDKINEEFI
EKGSNRRLSFIVAETYGDEEISIDQTAKLWRANVSAYIGPQETCVHEGRMAASFNLPMIS
YFCADQETSNKKYFRTFARTRPPDTQISKSLAALLLAYNWRKVIFLYLDSENDMFRKVAV
TIIKTLKTAKITILQTKSWYFPYQFPYSENPFHRLVEDTHQDARIYVILGSHDEHLGLLK
AMEERKLLTGGKYFVVGVELEQYDDKDPGRYMRGLLRDDIDPVVVKAFASYFGIVPTSPI
NMHDISVKVNEYMEKPPFNFSNPFFQLGITKVVSTEAGYLYDAVHLYAKALNHVIEKGED
PLNGTAIIEAIKGTHYQSAMGYMVYIDENGDAEGNYTLLARKPHHELPQSYGLYPVGLFT
REKNNSKLPTLVETSTIHWIGKYPPVAEPVCGFRGKKCVTRTSQIMGAVSGSIFLVLVIA
GLIFYRNWKYEQELDSLLWKVDFKDIQINEDDVTNVLGAKITRATHPLVRTSQVSLSSNP
DADFRYSAIFTTICRYRGRLLALKRVKKKSIDMTRSMKKELKMMRDLRHENLNPFIGACT
DAPNICIITEYCSRGSLRDILENEDVKLDNMFVASLVGDIIRGMIYLHDSPVKYHGKLKT
SNCLVDSRWVVKLSDFGLREFKKDSEEEEEDGNSTPKLEACLYKSPEILRLENLNGEEEL
GSQKGDVYSFSIILHELHSRQGPFGNCGLTHAQILQKVINRDPLQPPFRPPLEALENSFD
FVRDCLKECWAEDPEMRPDFKAIRTKLRPMRKGMKPNIFDNMMAMMEKYANNLEALVDDR
TDQLMEEKKKTEALLYEMLPRTVAEQLKRGNKVEAENFDSVTIYFSDIVGFTAMSAESTP
LQVVDFLNDLYTCFDSTIENYDVYKVETIGDAYMVVSGLPIRNGDQHAGEIATMSLHLLE
AVEKFQIKHRPNEGVKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGNQGRI
HCSLETKLLLEKLGGYNLTERGVVPMKGKGNQFTYWLKGENAEARAKRSEERSARRAILA
GSKNKNKTIQQTNPNIPRSSLKSKHKQNDVTKNNPISRCSSLDYPKKLRFARFDGEESSL
ENKSEERVHHVRA
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgtggataatctgtttgagcattgcttcagtgatatcattatcgtcaaccgaagaatac
gtattgggttatttgacgggatcccagagaaaaccgggagatttggaatattcaaggcct
ggtttaagaatatccggtgccatttcttatgccgttgataaaataaatgaagaatttata
gaaaaaggatcgaatcgtagattatcattcatcgttgcggaaacttacggtgatgaagaa
ataagcatcgatcaaacggctaaattgtggagagcaaacgtatccgcttatataggacca
caggaaacgtgcgtgcacgagggtagaatggccgcttcgtttaatctaccaatgatatca
tacttttgcgccgatcaagaaacatcgaataaaaaatatttcagaacttttgctcgtacg
agacccccggatactcaaatttcaaaatcgttggctgcacttttgctagcgtacaattgg
agaaaagttattttcttatatttggattcggaaaatgacatgtttcgaaaagttgccgtt
acgataataaaaactctaaagactgctaaaataactatattgcaaacgaaatcttggtat
tttccatatcagtttccatattcggaaaatccttttcatcgtttggtcgaggatactcat
caggatgcaagaatttacgtcatactcggaagtcacgatgaacatttaggacttttaaaa
gccatggaagaaagaaaattattaacgggtggtaaatatttcgtcgtcggcgtggaatta
gaacaatacgacgataaagatcctggaaggtacatgagaggattattaagagacgatata
gatccagtcgtcgtgaaagcatttgctagttatttcggtatcgtaccgacatcaccgata
aacatgcacgacataagcgttaaagttaacgaatacatggaaaaaccgccatttaatttt
tcaaatcccttttttcaattgggtataacgaaagtggtgagtacagaagcgggttattta
tacgatgccgttcatttatacgcgaaagctcttaatcacgtgattgaaaaaggtgaggat
ccattaaatgggacggctataattgaagctataaaaggaactcattatcaaagtgcgatg
gggtacatggtgtacatagatgaaaatggtgatgccgaagggaattatacgttattagca
agaaaaccacatcatgaattaccacaatcttacggtttatatcccgtaggtttgtttaca
agggagaaaaacaattcgaaattacccacattagtagaaacaagtacaatacactggatc
ggaaaatatcctccagttgcagaacccgtttgcggtttcagagggaaaaaatgcgtcacg
cgcacgagtcaaataatgggagccgtttccggttcaatttttttagttctcgtaattgcg
ggtttgatattctatagaaattggaaatacgagcaagaattagatagtttattgtggaaa
gtggattttaaagatatacaaataaatgaagatgatgttaccaacgtattaggtgcaaaa
ataaccagggcaactcatcctttagttcgtactagtcaagtttcattaagttcaaatcct
gatgccgatttccggtattcagctatttttacaacaatatgcaggtacaggggaagatta
ctcgctcttaaaagagttaaaaaaaaatcaatcgacatgacgaggagcatgaaaaaagaa
ttaaaaatgatgagagatttaaggcacgaaaaccttaatcctttcattggagcgtgtacg
gatgcacctaacatatgcataataacagaatattgttcgagaggttctttaagggatata
ttagaaaacgaagatgttaagttggacaacatgtttgtcgcttccctagtcggtgatatt
attcgcggaatgatttacctgcatgattctccagttaaatatcatggaaaattaaaaact
tcaaattgtctggtagattctcgatgggttgtgaaattatccgatttcggtttaagagaa
tttaaaaaagattctgaagaagaagaagaagatggaaattctacgcccaagttagaagcc
tgcttgtacaaaagtcctgaaatattacgactggaaaatttaaatggcgaagaagaattg
ggttcgcaaaaaggtgacgtttattcttttagcataattttgcacgaacttcacagtcgt
cagggaccttttggaaattgtggtttgacacatgcacaaattttacaaaaagttattaat
cgtgatccattacaacctcccttccggcctccgttggaagcacttgaaaatagtttcgat
tttgtacgagattgtttaaaagaatgttgggcagaagatcctgaaatgcgacctgatttc
aaagccataagaacaaaattaagaccaatgaggaaaggcatgaaaccaaatatttttgat
aatatgatggcgatgatggaaaaatatgcaaataatctcgaagcactcgttgatgacaga
acggatcaattgatggaagagaaaaaaaaaactgaagctttactttatgaaatgttaccg
agaaccgttgccgaacaactcaaaagaggaaataaagtcgaagcggaaaattttgattcc
gtcaccatttattttagcgacatagtcggtttcacggcaatgtctgccgaaagtacgcca
ttacaggttgtagattttcttaacgatttatacacgtgttttgattcgacgattgaaaat
tacgatgtttataaggtggaaaccataggtgatgcttacatggtcgtatctggacttccg
atacgaaacggtgatcaacacgctggagaaatagcaacaatgtctttacacttactggaa
gcagtagaaaaatttcaaataaaacacaggccgaacgagggtgttaaattaagaatagga
atacattcgggacctgtttgtgcaggggttgtaggtcttaaaatgccaagatattgtttg
ttcggtgatacggtcaacaccgccagtcgtatggaatcaactggaaatcaaggacgaata
cattgcagtttagaaacaaaattattactggaaaaattaggaggttataaccttacggaa
agaggagtcgtgccgatgaaaggaaaaggaaatcaattcacgtattggttaaaaggtgaa
aatgccgaagcgagagctaaaagatcggaagaaagatcagccagacgtgctatactcgca
ggttccaaaaacaaaaacaaaacaatacaacaaacaaatccgaacattccgagaagcagt
ttaaaaagtaaacataaacaaaacgacgtaacgaaaaacaatccgatatctcgatgttcg
agtttagattatccaaaaaaattaagatttgcaagattcgacggtgaagaatcatctctc
gaaaacaaatccgaagaacgagttcatcatgtccgtgcatag

DBGET integrated database retrieval system