KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM135890
Entry
Phum_PHUM135890   CDS       T01223                                 

Name
(RefSeq) Ryanodine receptor, putative
  KO
K04962  ryanodine receptor 2
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
KEGG Orthology (KO) [BR:phu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:phu04040]
    Phum_PHUM135890
   04990 Domain-containing proteins not elsewhere classified [BR:phu04990]
    Phum_PHUM135890
Ion channels [BR:phu04040]
 Voltage-gated cation channels
  Ryanodine receptor
   Phum_PHUM135890
Domain-containing proteins not elsewhere classified [BR:phu04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   Phum_PHUM135890
SSDB
Motif
Pfam: RYDR_ITPR RyR SPRY Ins145_P3_rec MIR RR_TM4-6 RIH_assoc Ion_trans EF-hand_7 GWT1 EF-hand_6 DUF996
Other DBs
NCBI-GeneID: 8234224
NCBI-ProteinID: XP_002424547
VectorBase: PHUM135890
UniProt: E0VEK3
AA seq 5058 aa
MAEAEGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLS
QCVFVIEQALSVRALQELVTAAGSESGKGTGSGHRTLLYGNAILLRHQNSDMYLACLSTC
SSQDKLSFDVGLQDHSLGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NDLSIVNASFHVTHWSVQPYGTGVSRMKYVGYVFGGDVLRFFHGGDECLTIPSTWSEEPG
QNMVVYEGGSVMSQARSLWRLELARTKWSGGFINWYHPMRIRHITTGRYLGVNENNELYL
VNREEATTSLSTFCLRQEKDDQKVVLEDKDLEVIGAPIIKYGDSTVIMQHSETGLWVSYK
SFETKKKGVGKVEEKQAILHEEGKMDDGLDFSRSQEEESRTARVIRKCSSLFTGSIKSLE
NIQATRRTSSFFATVNLTEIVMCLEDLINYFEQPEEEMEHEEKQNKLKALRNRQDLFQEE
GILNLILEAIDKINIITGQGFLVALPGEIGQNWEAISSYLYQLLAAIIKGNHTNCKEFAN
TNRLNWLFSRLGSQASGEGTGMLDVLHCVLIDSPEALNMMKDEHIKVIISLLEKHGRDPK
VLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTQLVDHVASVRPNIFVGRVENSAV
YQKWYFEVTLDHIEQTTHLKPHLRIGWANTSGYVPYPGGGEKWGGNGVGDDLYSYGFDGA
NLWTGGRKTEVVPEATEPYIKKGDIIGVALDLNVPIITFTMNGVQINATFKDFNLDGMFF
PVISCSSKLSCRFLLGGDHGKLKYIPPEEFSPLIECLMPQQVLSIDPCFYFGNLNKNVLA
GPWLVEGDTAFVPNPVDTSTITLPSYIENIRDKLAENIHEMWAMNKIEAGWIFGEIRDDV
RKIHPCLTQFEKLPPAEKRYDSQLAIQTLKTILALGYYITMDKPPSRIKQIRLPNETFLQ
PNGYKPAPLDLSAVALSIKMEELVDHLAENTHNLWAKERIQQGWTYGLNEDPDLLRSPHL
VPYIKVDDAIKKANRDTASETVRTLLVYGYNLDPPTGEQQEALLAEANKSREQDFRTYRV
EKNYAVSNGKWYFEFEILSSGPMRVGWARADCPPGNKLGSDEYTWAFDGFNEEKVFCGSG
ESFGKQWKIGDVVGVFLDLLDRTISFSLNGELLMDALGGETTFAEVQGDSFIPACTLGIG
QKARLTFGQDVNTLQYFSNCGLQEGYEPFCVNMNRPVTYWYTKDQPIFENTDESSDSMID
VLRIPAGSDSPPCLKISHNMFETMEKANWEFLRLSLPVICQSTLIDEEEKNKRWQEIKSR
QRRLLTESEHPTPAHIEQIMKSGFSINDIKGLARGYSEDAVEADEMLLNRPDIQNQGHSP
KPSRKGSLTRFEGRNHGGTMGSRKNNRSNSEIDINKLENEEKDKKTRGRSPFRFFSRRKD
GDRQRKNRTPEPGSPDYDHLSPPQIRISKADGKDSMAGDRNVNLQDKMSPGVDSVGNEPF
DVECLKLINEYFYGVRIFPGQDPSHVYVGWVTTQYHYFSNEFNQTKVRKASITKIDDFNN
VKERIDRQSCYMVKASELYNEVSSDTSGKGASQGMFIGCFVDTATGFITYTCEGKETSHK
YKMEPETKLFPAIFVEATSKEILQVELGRTSSTLPLSAAVLMNSERHITPQFPPRLKVQC
LKPNQWARVPNQSLQVHALKLSDIRGWSMLCEDPISMLAVHIPEEDRCIDVLELIEMERL
LSFHAHTLTLYSALCYQSNYRAAHILCQHVDERQLLYAIKSAYMSGPLRRGFYDLLISLH
LESHATTMEVSKNEYVIPLSQELKELYRDSDMYHSLSSLNMESVRPKMKMTDSSEQVENI
RELYSPYFPLNVVRDFVMQALEEAVEVNQVHNRDPIGGSNENLFLPLLKLVDRLLLVEVL
RDEDLKKLLIMMDPETWDETFDKSGKDEHRKGLLHMKMAEGAKLQMCYVLHHFGDIQLRH
RVESLIAFSAEFVGELQQDQLRRYTEIKQSDLPSAIAAKKTREFRCPPREQMNAILGFKN
LEDDDVENCPCGIELREKLNVFHSKLMSQVSLTALQEPLESEDEETSDKPTTMKKLYSLI
HAVKELEETPEPSEEPQKKSPEAIFRKVLISTIVRWAEESQIETSKLVREMFSLLVRQYD
SVGELIKALGKTYVTNAKTRDDAALMWVGLSQIRSLLPVQMSQEEEGLLRERLWKLVNNH
TFFQHPDLIRVLRIHENVMAVMMNTLGRRAQTQSDTPQTTDQGEAVPKEKDTSHEMVVAC
CRFLCYFCRTSRQNQKAMFDHLAFLLENSNILLSRPSLRGSTPLDVAYSSVMENTELALA
LREHYLEKIAVYLSRCGLQSNSDLVEKGYPDLGWDPVEGERYLDFLRFCVWVNGESVEEN
ANLVIRLLIRRPECLGPALRGEGEGLLRAIVDANQMSEKISDRRKLMDEAEGTMAMSDFQ
HPLPESDEDEDYIDTGAAILAFYCTLVDLLGRCAPDSTVIALNKNESIRARAILRSLVPL
EDLQGVLALRFTLQQPAAGEERAKSDMPSGLIPGHKQSIVMFLERVYGIETQELFFRLLE
DAFLPDLRCATMLDRSDGSESEMALAMNRYMGNSVLPLLIKHAKFYSEADNYASLLDATL
HTVYRLSKNRMLTKGQRESVSDFLVALTSQMQPSMLLKLLRKLTVDVSNLSEYTTVALRL
LTLHYDRCAKYYGSSSGQQSLYGASSDEEKRLTMVLFSNIFDSLSKMDYDPDLFGKALPC
LAAIGCALPPDYTLSKTFDDEIYERGGAGERGSYTPQPINTASIVLNTDLNSIVQKFSEH
YHDAWASRKLENGWTYGETWSDTNKTHPRLKPYSMLNDYEKERYKEPVRESLKALLAIGW
NVEHTEVDIPSSHRASMRRQSKPTSAESSTPFNYHPHPVDMTNLTLNKEMQNMAERLAEN
AHDIWAKKKKEELTACGGVVHPQLVPYDLLTDKEKRKDRERSQEFLKYLQYQGYKLHRPY
KGGETEQAAALSSVENRFAYSLLEKLIQYTDKAAINMKLLKPSSTFSRRTSFKTCSRDIK
FFSKVVLPLIEKYFNTHKNYFIAVATASNNVGAASLKEKEMVASLFCKLANLLRIRLTSF
GSDVRITVRCLQVLVKGVDAKSLVKNCPEFIRTSMLTFFNNTADDLSHTILNLHEGKYSH
LRGTHLKTCTSLTYVYSVVLPVLTSMFDHLASCEYGSDLLLDEIQVAAYKILGSLYTLGI
DGTLHGDRKYLKTEIDRHRPALGNCLGAFSSTFPVAFLEPHLNKHNQYSLLNRIADHSLE
AQDVMARMEQSMPSLEAILSDVDAFVESDKTHTDSPHIIDVVLPLLCSYLPFWWSQGPDN
VNPQGGNHVTMITAEHMNQLLKSVLNLIKKNIGNENAPWMTRIATYTQQIIINSSEELLK
DPFLPLAERVRKRTENMFHKEESLRGFIKSSSDDTSQVEAQIQEDWQLLVRDIYAFYPLL
IKYVDLQRNHWLRNNISEAEDLYKHVAEIFNMWSKSQYFLKEEQNFIAANEIDNMILIMP
TATRRTAVSSESGTPSSGNKKKKKKHREKKRDKDKEIQASLMVACLKRLLPVGLNLFAGR
EQELVQHCKDRYLKKLPENEISDFAKTQLTLPDKIDPADEMSWQHYLYSKLGSKKEVAVE
VKDKDKQIEELVCRIVAMAKVLYGLHMIDHPQQQGKAVYRSVVSTQRKRAVLSCFRQASL
HSLPRHRSINIFVKTYFEQWLQDENTGQEVMIEDLTQSFEDAELKKNDKNEDEAKPDPLT
QLVTTFCRGAMTERSGALQEDPLYMSYADIASKSCGEEEEEGGDEEEEGGGSSIHEQEME
KQKLLFHQARLANRGVAEMILLHISACKGIPSDMVMKTLQLGISILRGGNIEIQMGMLNH
LKEKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDADFICALF
RFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKELIDP
AGKANFFKAIGVASQVFNTLSEVIQGPCTQNQQALAHSRLWDAVGGFFFLFSHMQEKLSK
HSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMF
LKLKVLTETPSFKEIDYNNDGWITPKDFKEKMEQQKSYAPEEIEFMLMCCETNHDGKIDY
VTFTEKFYEPAKENGFNLAVMLTNLSEHMPNEPRLARFLETAGSVLSYFEPFLGRIEILG
GSKRIERVYFEIQESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEM
THASALMDVEDSSGSGKAREAAYRYVADDEEERLAKDPVKRSIVYVKSGISNAFQFFSPS
NIKRNISDFQQKPPLEQIKCFLKFFFYIFYYSGYGFASVIKYFLGMIMNLMRGPKEEATE
EVVEEKEDFGPLKPLGVPSLTGEETGSLAISHKDDNNKSDNLSSTSPSTGEENDENTTEE
GQDSPKEEQLTLQDLLGGDIAKKEAVLTAEAQSQQQAVMAAVESEAKQNATVGEPAAVSQ
IDFNAYGHRAVSFLARNFYNLKYVALVLAFCINFILLLYKVTNVEGENDSKSSNEAASSL
NDVFSGEKGDNFGSEEGGNESGEDEGEDIEIVHVSEDYFYMAHVLRLMAMLHSLVSLAML
IAYYHLKVPLAIFKREKEIARRLEFDGLYIAEQPEDDDIKSHWDKLVISAKSFPVNYWDK
FVKKKVRQKYSETYDFDSISNLLGMERTSFSAQENGKTGSGIIHFVMNIDWRYQVWKAGV
TITDHAFLYSLWYFVFSVFGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLILTVM
LLTIIVYIYTVIAFNFFRKFYVQEEDDEVDKKCHNMLTCFVFHLYKGVRAGGGIGDEIEP
PDGDEYEVYRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQLESVKEDMESNCFICGI
GKDYFDKVPHGFDTHVAQEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRCWDFFP
VGDCFRKQYEDELGGGNN
NT seq 15177 nt   +upstreamnt  +downstreamnt
atggcggaggcggaagggggatctgaacaagatgatgtttcatttttacgaacggaagat
atggtttgtctttcttgtacagccacaggtgaaagagtttgtcttgctgctgaaggattt
ggtaacagacattgttttttggaaaatattgctgataaaaatattccacctgatttatct
caatgtgtttttgttattgaacaagctttatccgttagagctttacaagaattggtcaca
gcagccggatcagaatccggaaaaggaacaggttcaggccaccgtaccttgctttatggt
aatgctattcttttgagacatcaaaatagtgacatgtatttggcttgtctgtcaacttgt
tcttcacaagataaattatcttttgatgttggtttgcaagatcattctcttggagaagct
tgctggtggacagttcatccggcttctaagcaaagatccgagggtgaaaaagttcgtgtc
ggtgacgatttaatattagtttctgttgctaccgaaagatatttgcacacgaccaaagaa
aacgatttgtcgattgttaacgcatcatttcatgtgacccattggtccgtacaaccgtat
ggtacaggtgtgagcagaatgaaatatgtcggttatgttttcggaggagatgttttaaga
ttttttcacgggggtgatgaatgtcttacgattccatccacgtggagcgaagaacctggg
caaaatatggtggtctacgaaggtggtagtgttatgagtcaagcaagatcgctttggcgt
ttggaattggcaaggaccaaatggtctggaggatttattaattggtaccatcccatgagg
attcgacacataacgacaggtcgctatttgggagtcaatgaaaacaacgaactttattta
gtaaatagagaagaagccacgacgtctctttccactttttgtttgcgtcaggaaaaagat
gatcaaaaagtagttttagaagacaaagatcttgaagtgatcggagcacctataatcaaa
tacggtgacagcacagttataatgcaacattcagaaacgggactttgggtatcttataaa
tcttttgaaacaaagaaaaaaggtgttggaaaagttgaagaaaaacaagctattttacat
gaagaaggaaaaatggacgatggtttggattttagtagatcacaagaagaagaatctaga
actgcaagagttataagaaaatgcagttctctctttacaggatctatcaagagtcttgaa
aatatacaagcaacaagaagaacatcatcattttttgcaaccgttaatttaaccgaaatc
gttatgtgcttggaagatttaattaattattttgaacaacccgaagaagaaatggagcat
gaagaaaaacaaaacaagttaaaagctttgagaaatcgacaagatttatttcaagaagaa
ggaattttaaatttaattcttgaagccattgataaaataaatataattaccggacaagga
tttttagttgctttacctggagaaatcgggcaaaattgggaagccatttccagttattta
tatcaacttttggctgccataattaaaggaaatcataccaattgtaaggaatttgccaac
acgaatcgtttaaattggctttttagtagattaggatcacaggcatctggtgaaggtacc
ggaatgttggacgtacttcattgtgttctaattgattcacccgaagctttaaatatgatg
aaggatgaacatattaaagttattatttctttgctggaaaaacatggtagagatccaaaa
gtattagacgttttatgttctctgtgcgtgggaaacggtgtagctgtacgaagttctcaa
aacaacatttgtgattttttattacccggaaagaatcttttactacaaacgcaactggtc
gatcatgttgccagtgtcagacccaatatattcgttggtcgcgttgaaaattcggcagtt
tatcaaaaatggtattttgaagtaacattagatcacattgaacaaacaactcatttaaaa
ccacatttgagaatagggtgggctaacacgtcgggatacgttccctatcctggaggagga
gaaaaatggggaggaaatggagtaggagatgatttatattcttatggtttcgacggtgcc
aatttatggaccggaggaagaaaaacagaggtagtgcctgaggcaactgaaccatatata
aaaaaaggagatattattggagtggctcttgatttgaatgttccaataataacttttaca
atgaacggcgttcaaattaatgcaacttttaaagattttaatttggatggtatgtttttt
ccggtaatcagctgttcatctaaactaagttgccggtttttgcttggcggagatcatggt
aaattaaaatatattccacctgaagaattttctcccctcattgaatgtttgatgccacaa
caagtcttatctattgatccatgtttttattttggaaatttaaataaaaatgtactagcc
ggtccttggttagtcgaaggagatacggcattcgtacctaatccagtcgatacatcaacg
ataacacttccaagttacattgaaaatattcgggataaacttgcggaaaatattcacgaa
atgtgggcaatgaataaaatagaagcaggttggatatttggagaaataagagatgacgta
agaaaaattcatccatgtttgacacaatttgaaaaattaccacccgctgaaaaaagatat
gattctcagctagccatacaaacattaaagaccattttggcattgggttattacataacc
atggataaacctccttctcgtattaaacagatacggcttccaaacgaaacatttttacaa
ccgaacggatataaacctgctcctttggatttaagtgccgtagcattaagcataaaaatg
gaagaattagttgatcatttagccgaaaatactcacaatttgtgggctaaagaaagaatt
caacaaggttggacgtacggtttaaacgaggatcctgatttattaagaagcccgcattta
gttccatacattaaagttgatgatgcaattaaaaaagccaatcgagatacggctagcgaa
acggttcgcacacttcttgtgtacggatataatttagatccgccaacaggagaacaacag
gaagcattgctggctgaggctaataaaagtagagaacaagattttagaacatatcgagtt
gaaaaaaattacgctgtcagtaatggaaaatggtattttgaatttgaaattttatcgtct
ggtcccatgagagttggttgggcgagagctgattgtccacctggaaacaaattaggaagc
gacgagtacacttgggcttttgatggctttaacgaagaaaaagttttttgcggatccgga
gagtcttttggaaagcaatggaaaataggagacgtagttggagtgtttttagatttacta
gacagaaccataagtttttctcttaacggtgagcttttaatggatgctttaggaggagaa
actacatttgccgaagtgcagggagattcttttatacctgcttgcacgcttggtatcggt
caaaaagctcgattgacttttggtcaagacgtcaacactttgcaatacttttcaaattgc
ggattacaagaaggctatgaaccattttgcgtgaatatgaatcgtccagtaacttattgg
tacacaaaagatcaaccgatatttgaaaatacagacgaaagttcagattcaatgattgat
gtcctcagaataccggcgggatctgactctcctccttgtcttaaaatcagtcataatatg
tttgaaacaatggaaaaagcaaattgggaatttttacgtctttcactaccagttatttgt
cagtctactttgattgatgaagaagaaaaaaacaaaagatggcaggaaataaaatctagg
caaaggcgtttactaaccgagtctgaacatcccacacctgctcacatcgaacaaataatg
aaatctggtttttctatcaatgatattaaaggccttgcaagaggatattcagaagatgcc
gttgaagctgatgaaatgctcttaaacagaccagacattcaaaatcaaggtcattccccg
aaaccttctagaaaaggttctttgacaaggtttgagggtaggaatcacggaggtacaatg
ggttctagaaaaaacaacagatctaacagtgaaatagatattaacaagctagaaaatgaa
gaaaaggataaaaaaactagaggcagatctccttttcgatttttttcgcgaagaaaagat
ggagatcgacaaaggaaaaacagaactcccgaaccaggttctcccgattacgatcacttg
tcacctccacaaatccgaatttcaaaagccgatggtaaagattcaatggcaggcgataga
aatgttaatttacaagacaaaatgtctccgggagtcgattccgtaggaaacgaaccattc
gacgtagaatgtttaaaacttataaatgaatatttttacggagtcagaatatttccggga
caggatccctcccatgtttacgtcggatgggtaacaacgcaatatcattatttcagtaat
gaattcaatcaaaccaaagtgagaaaagcttcaataactaaaattgacgattttaataat
gtaaaagaaagaattgatcgtcaaagttgttacatggttaaagcatcagaattatacaat
gaagtatcaagtgatacctctggtaaaggggcttctcagggaatgtttatcggttgtttt
gttgatacggccacaggttttataacgtatacctgtgagggtaaagaaaccagtcacaaa
tataaaatggaacccgaaacaaaacttttcccagcaatttttgtcgaagcaacaagtaaa
gaaattttacaagtagaattgggtcgaacttcatccactctgcccttatcagctgcggtt
ttaatgaactctgaacgtcacatcactcctcagtttcctccaaggttgaaagttcaatgt
ctgaaaccaaatcaatgggcgcgagtacctaatcaatcattgcaagttcatgctcttaaa
ttgtccgatataagaggttggagtatgttgtgcgaagatccgatttcaatgctcgccgtt
cacattcccgaagaagatagatgcattgatgttcttgaattaatcgaaatggaacgttta
ttaagcttccacgctcacacgttaactctatactcggctttatgctatcaatcgaactat
agagcagctcatattttatgtcagcacgtggatgaaagacaacttttatatgcaattaaa
tcagcttatatgtcgggtcctttaagaagaggattttacgatttgttaatttctttacat
ttggaatctcatgcgactacaatggaagtttctaaaaatgaatacgtgattccgttaagt
caagaattaaaagaattgtatcgagattcagatatgtatcacagtttaagttcgctaaat
atggaatcggtgagaccaaaaatgaaaatgactgattcttcagaacaagtggaaaatatt
cgagaactttatagtccatattttcctttgaatgtcgttagagattttgttatgcaagct
ttagaagaagcagttgaagttaatcaagttcataatcgggatcccatcgggggaagcaat
gaaaatttatttttgccattattaaaacttgtagacagacttttacttgttgaagttctt
cgagatgaagatttaaaaaagcttttgattatgatggatcctgaaacttgggatgaaaca
tttgataaaagtggcaaagatgaacatagaaaaggattgttacatatgaaaatggcggaa
ggagccaaacttcaaatgtgttacgttttacatcattttggcgacattcaattaaggcac
agagtcgaatctttgatagcattcagtgcagaattcgttggtgagttgcaacaggatcaa
ctcagaagatatacagaaataaaacaatcggatttaccatctgccattgcggctaaaaaa
actcgagagtttagatgtccaccgagagaacagatgaacgccatccttggttttaaaaac
cttgaagatgatgacgtagaaaattgtccgtgtggaatagaattaagagaaaaattaaac
gtttttcattcgaagctaatgagccaagtttcattaacggctcttcaagagccactggaa
agtgaggatgaagaaacgagtgataaacccacaacaatgaagaaactttatagcctaata
catgccgttaaagaattggaagaaactcctgaaccttcagaagaaccacaaaaaaaatct
ccagaggcaatttttcgaaaggttcttatatcgaccattgtgcgatgggccgaagaatct
caaatagaaacatctaaactggttagagaaatgtttagtcttttggttcgtcaatatgat
agcgttggcgaattgataaaggctttgggaaaaacatacgtgacgaatgcgaaaactcgc
gacgatgctgctcttatgtgggtcggattaagtcaaatacgttcattgctacccgtacaa
atgtcacaagaggaagaaggattactaagagaaagattatggaaattagtaaataatcac
acgtttttccaacacccggatttgattagagttttacgtattcacgaaaacgttatggcc
gtcatgatgaacactttgggtcgtagagcacaaactcaatcagatacgcctcaaacgacc
gatcaaggagaagctgtgccaaaagaaaaagacacatctcatgaaatggtcgttgcatgc
tgtcgttttctctgctatttctgtagaacatcaaggcaaaatcaaaaagcaatgtttgat
catttagctttcttattagaaaacagtaatattttactttcccgtccatctttgagaggt
agcactccgttagatgttgcatactcttctgttatggaaaatacagaattagctcttgct
cttagagaacattatttagaaaaaattgctgtttatttatctcggtgtggactacaatca
aattcggatttagttgaaaaaggttatccagatttgggttgggatcctgttgaaggagaa
agatatttagattttcttagattttgcgtttgggtaaatggggaaagcgtggaagaaaat
gcaaatttggttattcggctattaattcgtcgtccagaatgtctcggaccagcgttaaga
ggagaaggagaaggtcttttacgtgcaatagtggatgctaatcagatgtctgaaaaaata
tcggatcgacgaaaattaatggatgaagctgaaggtacgatggcaatgtcagattttcaa
catcccttacccgaaagtgatgaagatgaagattacattgatactggagctgcaatactt
gcattttattgtactttagtagatttattgggtagatgtgcaccagattcaaccgttatc
gctttgaataaaaatgaatccatcagagctcgggccattcttcgatctttagttccgctg
gaagaccttcaaggggttttagcattgcgatttactctccaacaaccagcagccggggaa
gaaagagccaaaagtgacatgccctcaggtctaattcccggtcataagcaaagtatagtt
atgtttttagaacgagtctacggaatcgaaacgcaagaattatttttcagacttttagaa
gatgcatttttaccagatttaagatgtgcaactatgcttgacagaagtgatggatctgaa
tcggaaatggctttggcaatgaatcgatatatgggaaattctgttttaccacttttgata
aaacatgcaaaattttacagtgaagcagataattatgcgagtcttttagatgcaactctt
cacacggtttatcgcttatcaaaaaatagaatgttgacaaagggacaaagagaatctgtt
tcagattttttggtggcattgacaagtcaaatgcaaccgagcatgcttttaaaactttta
agaaaattaaccgttgatgtttctaatttatcagaatatacgaccgtcgctttaagactt
ttaactcttcattacgatcgttgtgctaaatactacggatcgagtagcggccaacaaagt
ttgtatggggcgtcaagcgatgaagaaaaacgactcacaatggttttgttcagtaacata
tttgattcgttatccaaaatggattatgatccagatttatttggtaaagctttaccctgt
ttggctgcaattggttgtgctctgcctccagattatacactttcgaaaacatttgatgac
gaaatttacgaacgaggaggagctggagaacgtggctcttacactcctcagcctataaac
actgcaagcattgtattaaacacagatctgaattcaattgttcaaaaattttctgaacat
tatcatgatgcttgggctagtagaaaacttgaaaatggatggacgtatggagaaacgtgg
tctgacacaaacaaaactcatccgagattgaaaccttatagtatgcttaatgattacgaa
aaagaaagatacaaagaacccgttagggaatctctcaaggctttattggcgatcggttgg
aatgttgaacatactgaagttgatataccatcaagccatagagcttcaatgcgtcgacag
tcaaaacccacatctgcggaatcatcaacgccatttaattatcatccgcatccggttgat
atgactaatttaacgttgaataaagaaatgcaaaatatggcagaaagacttgctgaaaac
gctcatgatatttgggcaaagaaaaaaaaagaagaacttacggcttgcggtggtgtcgta
catccacaattggttccctatgaccttttgaccgataaggaaaagagaaaagatcgtgaa
aggtcgcaagaatttttaaaatatcttcagtaccaaggttacaaacttcatagaccgtac
aaaggaggagaaacggaacaagctgcagcgctgtcgtccgttgaaaatcgtttcgcatac
agtcttttggaaaaattaatacaatacaccgacaaagcagccattaacatgaaactatta
aaaccttcgtcaacttttagccgaagaacgagttttaaaacgtgttcgagggatataaaa
tttttttcaaaagttgttttgcctttgatcgaaaaatattttaatactcataaaaattat
ttcattgctgtggcgacagcttcgaataatgtcggtgctgcttcactcaaagaaaaagaa
atggttgcgagtttattctgtaagttggctaacctgttaagaattcgtttaacttcgttt
ggatcggatgttcgaataactgtcagatgtcttcaagtattagttaaaggagttgatgca
aaatctttggttaaaaattgtcccgaatttattcgtacgtccatgttgacattttttaat
aataccgctgatgatttgagtcacacaattttaaatcttcacgagggaaaatatagtcat
ttgagagggactcatttgaaaacttgcacttctttgacatacgtctattcggttgtttta
cctgttctgacatccatgtttgatcatttagccagttgtgaatacggtagtgatttatta
cttgatgaaattcaagtggccgcatataagatattaggaagtttatacacgttgggaatc
gatggtacccttcacggtgataggaaatatttaaaaacggaaatcgatcgacacagaccg
gcattgggaaattgtttgggagctttttcttcaacatttccggttgcgtttttggaacct
catttaaataaacataatcaatattcattgcttaatcgtatagccgatcattcgttagaa
gcccaggatgtaatggctagaatggagcaaagtatgccatctttagaagccattttgtcg
gatgtggatgcttttgtcgaatctgataaaacgcacacggattctcctcatataattgat
gtcgtccttccacttttatgttcttatcttcccttttggtggagtcaaggaccagataac
gttaatccacaaggagggaatcatgtcaccatgataacagcagaacacatgaatcaatta
ttaaaaagcgtattaaatttaataaaaaaaaatatcggaaacgaaaacgcgccttggatg
acgagaatagcaacttacactcaacaaataataattaattcatcggaagaacttcttaag
gatccatttttgcctttggccgaaagagtgagaaagagaacagaaaatatgtttcataaa
gaagaatctttacgtggttttataaaatcttcgagcgatgacacttcgcaggtggaagct
caaattcaagaagattggcaacttttagttcgagatatttacgcattttaccctcttttg
ataaaatacgtagatttgcaaagaaatcattggttaagaaataacataagcgaagcagaa
gatctttataaacacgtggctgaaatttttaacatgtggtctaaatctcagtacttttta
aaagaagaacaaaattttattgcggcaaacgaaatcgataatatgatactcataatgcca
acggcaacgaggaggacagcagtatcatcagagagtggtacaccatcgtcgggtaataaa
aaaaagaaaaagaagcatcgggaaaagaagagagacaaagataaagaaatacaagctagt
ttaatggtggcttgtttgaaaagattattacccgttggacttaacttatttgccggaaga
gaacaagaattggtacaacattgcaaagatagatacttaaagaaactacccgaaaacgaa
atatcagattttgcaaaaactcaattaacattaccagataaaattgatcccgctgacgaa
atgtcttggcagcattacctgtattcaaaattaggaagtaaaaaagaagttgcggtcgaa
gtaaaagataaagataaacaaattgaagaacttgtatgtagaattgttgcaatggcaaaa
gttttgtacggtcttcatatgatagatcatccgcaacagcagggaaaagccgtttaccga
tctgttgtatcaactcaaagaaaacgagccgtactttcatgttttcgacaagcttctcta
cattctctccccaggcatagatcgattaatatttttgttaaaacatatttcgaacaatgg
ttgcaagatgaaaatacaggtcaagaagttatgattgaagatttaacgcaatcgtttgaa
gatgccgaacttaaaaaaaatgataaaaatgaagatgaagcaaaaccggatcctctaact
caattggttacgacattttgtcggggagctatgacggaacgaagcggagccctacaggaa
gatccattgtatatgtcttacgcagatattgcatcaaaatcttgcggtgaagaagaggaa
gagggaggagatgaagaagaagaaggaggaggttcttccattcatgaacaagaaatggaa
aagcaaaaattattgtttcatcaagctcgtttagccaataggggtgttgcagaaatgatt
cttcttcacatttcggcttgtaaaggaattcccagcgatatggttatgaaaactcttcaa
ctcggtatatctattctaagaggaggaaacattgaaattcaaatgggaatgttaaatcat
ttaaaagaaaaaaaagatgtcggatttttcacatcgattgcgggactcatgaattcttgc
agcgtattagatttggatgcatttgaaagaaatacaaaagctgaaggattgggagtcggt
tcagaaggagctgctggagaaaaaaatatgcacgatgcggattttatttgcgcacttttt
agatttattcaattgacatgcgaaggacacaatttggaatggcaaaattatttaagaact
caagcgggtaacacgacgactgtaaacgttgttatttgcacggttgattaccttcttcgc
cttcaagaatccataatggatttttattggcattattcgagtaaagaattaattgatccc
gcgggaaaagcaaatttttttaaagctatcggagtggcgagtcaagtttttaacacttta
tcagaagtcattcaaggtccatgtacgcaaaatcaacaagcactcgctcattctaggttg
tgggatgcagtcggaggttttttctttttattttctcacatgcaagaaaaattatcaaag
cattccagtcaagttgatttacttaaagaattattaaatcttcaaaaagacatgataaca
atgatgttatcaatgctcgaaggtaatgtcgttaatggtacaatcggaaaacaaatggtg
gatacattagttgaatctgcatccaacgttgaactcattcttaaatatttcgacatgttt
cttaaactaaaagttttaacggaaactccatcgtttaaagaaatcgattataacaacgat
ggttggattacacctaaagattttaaagaaaaaatggaacagcaaaaaagttatgctcca
gaggaaatagaatttatgcttatgtgttgcgaaacaaatcacgatggaaaaattgattac
gtaacatttactgaaaaattttacgaacctgcaaaagaaaatggatttaatttagccgtc
atgttgacgaatttatctgaacacatgcctaatgaaccgagattggcaagatttttagaa
acggccggaagtgttttaagttatttcgaaccctttttgggaagaattgaaattttagga
ggaagtaaacgtatcgaaagggtttatttcgaaattcaagaatcaaatatcgaacaatgg
gaaaaaccgcaaattaaagaatcaaaaagagctttcttttattcgattgtcaccgaagga
ggagataaagaaaaacttgaagcttttgttaatttttgcgaagatgcaattttcgaaatg
acccatgcaagtgctcttatggatgttgaagattcgagcggaagcggaaaagctagagaa
gcagcttatcgatatgttgcagatgatgaagaagaacgattggccaaagatccagtaaaa
agaagcattgtatatgttaaaagtggaataagcaacgcttttcaatttttctccccttcg
aacatcaaacgtaacatttcggatttccagcaaaaacctccgctggaacaaataaaatgt
tttttaaaatttttcttttacatattttattatagcggttacggatttgcaagtgttata
aaatattttcttggtatgataatgaatttgatgagaggtcctaaagaagaagcaacggag
gaagtagtcgaagaaaaagaagattttggtcctttgaaaccactgggagtaccttcatta
acaggagaagaaaccgggtcgctcgcaatatctcataaagatgataataataagtcggat
aatttatcatcaacgtctccttcgacaggggaagaaaatgatgaaaatacaacggaagaa
ggacaagactcgcctaaagaagaacaattaactttacaagatcttttaggaggagatata
gcgaaaaaagaagccgttctcacggcagaagcacaatcacaacagcaagcagtgatggcc
gctgtcgaatcagaagcaaaacaaaatgctaccgttggtgaacctgctgccgtatcgcaa
attgattttaatgcctatggtcatagagctgtcagttttttggcgcgaaatttttataat
ctcaaatatgttgctttagtattggcattttgtattaattttattcttctgctttacaaa
gtgacgaacgtggaaggagaaaatgatagcaaatcatcaaacgaagcggcaagttcttta
aatgatgttttcagcggcgagaaaggtgataattttggtagtgaagaagggggtaacgaa
agtggagaggatgaaggggaagacattgaaattgtacacgtgagcgaagattatttttac
atggctcacgttttacgattgatggccatgttacattctctcgtatctctagccatgctc
attgcttactaccacttaaaagtacctttggctatatttaaaagagaaaaagaaattgct
agacgtttagaatttgacggtttgtacatcgccgaacaaccggaagatgatgatatcaaa
tctcattgggataaacttgttatatcggccaagtcgtttccggtcaactattgggataaa
tttgttaagaaaaaagtcagacagaaatacagcgaaacttacgatttcgattcgatcagt
aatttattaggaatggaaagaacgtcgtttagcgcacaagaaaatgggaaaaccggctct
ggaatcatacacttcgtcatgaacatcgattggaggtatcaagtttggaaagctggagtc
acgataaccgatcatgctttcctatacagtctttggtattttgttttttccgtttttgga
aatttcaataattttttctttgccgctcatttgttagacgttgccgtgggttttaaaacg
ttaagaacaattttacaatctgtcacacacaacggaaaacagcttatattaacggtcatg
ttattaacaatcatcgtctatatatacacggtcatcgcttttaacttttttagaaaattt
tacgtacaagaagaagacgacgaagttgataaaaaatgtcataacatgttaacgtgtttc
gtatttcacttgtacaaaggtgtgagagctgggggtggaatcggtgatgaaattgaaccc
cccgacggagacgaatatgaagtttatcgtatattattcgacataacatttttctttttc
gtcatcgttatattgttggccatcattcaaggtttgatcattgacgcattcggagaattg
agagatcaattggaaagtgttaaagaagacatggaatcaaattgttttatttgcggtata
ggaaaagattatttcgacaaagtacctcacggatttgatactcacgttgctcaagaacat
aatttggccaattacatgttttttttgatgcatcttataaacaaaccggatacggaatac
acgggtcaagaaacttacgtttggaacatgtatcaacaaagatgttgggatttttttcca
gtcggagattgttttagaaaacaatatgaagatgaattaggaggaggaaataattaa

DBGET integrated database retrieval system