KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM137520
Entry
Phum_PHUM137520   CDS       T01223                                 

Definition
(RefSeq) protein Mo25, putative
  KO
K08272  calcium binding protein 39
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    Phum_PHUM137520
SSDB
Motif
Pfam: Mo25 MOR2-PAG1_C
Other DBs
NCBI-GeneID: 8234354
NCBI-ProteinID: XP_002424600
VectorBase: PHUM137520
UniProt: E0VEQ6
AA seq 336 aa
MPLFGKSAKSPAEVVKSLKEAISALERGDKKAEKAQEEVSKNLVLIKNMLYGTSEAEPHT
EIIVAQLAQELYNSNLLLILIQNLNRIDFEGKKDVAQVFNNILRRQIGTRSPTVEYTCTK
PEILFTLMKGYEHQEIALNCGTMLRECARYEALAKIMLYSEDFFNFFRYVEVSTFDIASD
AFSTFKELLTRHKVLCAEFLEVNYDKVFTHYQRLLNSENYVTRRQSLKLLGELLLDRHNF
AVMTRYISSPDNLKLMMNMLKEKSRNIQFEAFHVFKVFVANPNKPKPILDILLRNQEKLV
EFLTRFHTDRSEDEQFNDEKAYLIKQIKELKPVTEH
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgcctttatttggaaaatcagctaaaagtccagctgaggtggttaaatctcttaaagaa
gcaataagtgcactggaaagaggagacaaaaaagctgaaaaagcacaagaagaagtcagc
aaaaatttggttcttattaaaaatatgttgtatggaacatcagaagcagaacctcatact
gaaataattgttgctcaattagctcaagaactgtataattcaaatttgcttctcatatta
attcaaaatttaaatcgcatagactttgaagggaaaaaagatgtggctcaggtttttaat
aacattcttagacgccaaatagggactaggtcaccaactgtggaatatacatgcacaaaa
ccagaaatattatttaccttgatgaagggatatgagcatcaagaaattgctctcaattgt
gggacaatgctcagagaatgtgcacgatatgaagcattggctaaaataatgctttattct
gaagatttttttaattttttcagatatgtggaagtttctacttttgatattgcatctgat
gcattttctacttttaaggagcttctcacaaggcataaagttttgtgtgctgaattttta
gaagtgaattatgataaggtattcacacattatcaaagattattgaattctgaaaattat
gttacaaggcgtcaaagcctcaaacttttgggagaacttttattggatcgtcataatttt
gctgttatgacaagatatatatctagcccagataatttaaaactgatgatgaatatgctt
aaggaaaaatctcgaaatatacaatttgaagcttttcacgtgtttaaggtatttgtggcc
aatccaaacaagcctaaaccaatattagatattttattgagaaaccaagagaaattggtg
gaatttttaactaggtttcacacagatcgttctgaagatgaacaatttaatgacgaaaaa
gcttatctcataaaacaaataaaggaattaaaaccggtgacagaacattag

DBGET integrated database retrieval system